Gene Gene information from NCBI Gene database.
Entrez ID 8260
Gene name N-alpha-acetyltransferase 10, NatA catalytic subunit
Gene symbol NAA10
Synonyms (NCBI Gene)
ARD1ARD1AARD1PDXS707LZMSMAAMCOPS1NATDOGDNSTE2hARD1
Chromosome X
Chromosome location Xq28
Summary N-alpha-acetylation is among the most common post-translational protein modifications in eukaryotic cells. This process involves the transfer of an acetyl group from acetyl-coenzyme A to the alpha-amino group on a nascent polypeptide and is essential for
SNPs SNP information provided by dbSNP.
21
SNP ID Visualize variation Clinical significance Consequence
rs387906701 A>G Pathogenic Missense variant, coding sequence variant
rs587776457 A>T Pathogenic Splice donor variant
rs587780562 C>A Pathogenic Missense variant, coding sequence variant
rs863225427 T>G Pathogenic Missense variant, coding sequence variant
rs878853263 A>C,T Pathogenic Intron variant, missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
19
miRTarBase ID miRNA Experiments Reference
MIRT031471 hsa-miR-16-5p Proteomics 18668040
MIRT052136 hsa-let-7b-5p CLASH 23622248
MIRT045213 hsa-miR-186-5p CLASH 23622248
MIRT042605 hsa-miR-423-3p CLASH 23622248
MIRT732214 hsa-miR-342-5p Luciferase reporter assayqRT-PCRWestern blot 26646451
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0004596 Function Protein-N-terminal amino-acid acetyltransferase activity IDA 19480662
GO:0004596 Function Protein-N-terminal amino-acid acetyltransferase activity IDA 25489052
GO:0004596 Function Protein-N-terminal amino-acid acetyltransferase activity IEA
GO:0005515 Function Protein binding IPI 15496142, 16507339, 19480662, 21295525, 25416956, 25489052, 27708256, 28514442, 31515488, 32296183, 32814053, 33961781, 35156780, 36012204, 36442525
GO:0005634 Component Nucleus IDA 15496142, 25732826
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300013 18704 ENSG00000102030
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P41227
Protein name N-alpha-acetyltransferase 10 (EC 2.3.1.255) (N-terminal acetyltransferase complex ARD1 subunit homolog A) (hARD1) (NatA catalytic subunit Naa10)
Protein function Catalytic subunit of N-terminal acetyltransferase complexes which display alpha (N-terminal) acetyltransferase activity (PubMed:15496142, PubMed:19420222, PubMed:19826488, PubMed:20145209, PubMed:20154145, PubMed:25489052, PubMed:27708256, PubMe
PDB 6C95 , 6C9M , 6PPL , 6PW9 , 9F1B , 9F1C , 9F1D , 9FPZ , 9FQ0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00583 Acetyltransf_1 13 128 Acetyltransferase (GNAT) family Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:12464182}.
Sequence
MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKM
EEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALH
LYSNTLNF
QISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKV
ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
Sequence length 235
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
98
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Intellectual disability Pathogenic; Likely pathogenic rs797044868, rs878853264, rs1603290366, rs2065185202 RCV001257765
RCV000824880
RCV000851497
RCV001195646
Microphthalmia, syndromic 1 Pathogenic; Likely pathogenic rs587776457, rs387906701, rs1603289774, rs1603289772, rs2065185202, rs2065171820 RCV000088650
RCV005055521
RCV001215737
RCV001215735
RCV002287477
RCV001249627
NAA10-related disorder Likely pathogenic; Pathogenic rs587780563, rs797044868 RCV004528848
RCV003401042
NAA10-related syndrome Likely pathogenic; Pathogenic rs878853264 RCV005868141
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Intellectual disability, autosomal dominant Likely benign rs1057519620 RCV000437786
Kleine-Levin syndrome Uncertain significance rs2521339211 RCV002509902
Malignant lymphoma, large B-cell, diffuse Benign rs2269370 RCV005902154
Nonpapillary renal cell carcinoma Conflicting classifications of pathogenicity rs2065169457 RCV005912477
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alcohol Related Disorders Associate 34200686
Anophthalmos Associate 30842225
Arthrogryposis multiplex congenita distal X linked Associate 29656860
Atrophy Associate 33335012
Attention Deficit Disorder with Hyperactivity Associate 31174490
Autism Spectrum Disorder Associate 31127942
Autistic Disorder Associate 34200686
Brain Diseases Associate 35039925
Breast Neoplasms Associate 26663084, 32162442
Carcinoma Hepatocellular Associate 12079511