Gene Gene information from NCBI Gene database.
Entrez ID 826
Gene name Calpain small subunit 1
Gene symbol CAPNS1
Synonyms (NCBI Gene)
CALPAIN4CANPCANPSCAPN4CDPSCSS1PPH6
Chromosome 19
Chromosome location 19q13.12
Summary This gene is a member of the calpain small subunit family. Calpains are calcium-dependent cysteine proteinases that are widely distributed in mammalian cells. Calpains operate as heterodimers, comprising a specific large catalytic subunit (calpain 1 subun
miRNA miRNA information provided by mirtarbase database.
481
miRTarBase ID miRNA Experiments Reference
MIRT023039 hsa-miR-124-3p Microarray 18668037
MIRT048635 hsa-miR-99a-5p CLASH 23622248
MIRT048473 hsa-miR-100-5p CLASH 23622248
MIRT047067 hsa-miR-183-5p CLASH 23622248
MIRT047067 hsa-miR-183-5p CLASH 23622248
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
NRF1 Activation 18234454
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0004198 Function Calcium-dependent cysteine-type endopeptidase activity IDA 17646163
GO:0004198 Function Calcium-dependent cysteine-type endopeptidase activity IEA
GO:0004198 Function Calcium-dependent cysteine-type endopeptidase activity TAS 8702541
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 10639123, 18519038, 18761085, 25416956, 27173435, 28319173, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
114170 1481 ENSG00000126247
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P04632
Protein name Calpain small subunit 1 (CSS1) (Calcium-activated neutral proteinase small subunit) (CANP small subunit) (Calcium-dependent protease small subunit) (CDPS) (Calcium-dependent protease small subunit 1) (Calpain regulatory subunit)
Protein function Regulatory subunit of the calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. Essential for embryonic development (By similarity). {ECO:000
PDB 1KFU , 1KFX , 4PHJ , 4PHK , 4PHM , 4WQ2 , 4WQ3 , 5D69 , 6QLB
Family and domains
Sequence
MFLVNSFLKGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR
ILGGVISAISEAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATEL
MNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQ
FDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMF
RAFKSLDKDGTGQIQVNIQEWLQLTMYS
Sequence length 268
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Shigellosis   Degradation of the extracellular matrix
Formation of the cornified envelope
Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Pulmonary hypertension, primary, 6 Pathogenic rs760597333, rs748860589 RCV003991192
RCV003991193
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 37418137
Carcinogenesis Associate 24628706
Carcinoma Hepatocellular Associate 22355367, 23349941, 36233276, 39207047
Carcinoma Ovarian Epithelial Associate 28535511, 33760208
Carcinoma Renal Cell Associate 24514433
Cholangiocarcinoma Associate 23349941
Coronary Disease Associate 33964876
COVID 19 Associate 35421970
Glioblastoma Associate 24628706
Glioma Associate 24628706