Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	81930
Gene name Gene Name - the full gene name approved by the HGNC.	Kinesin family member 18A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KIF18A
Synonyms (NCBI Gene) Gene synonyms aliases	MS-KIF18A, PPP1R99
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p14.1
Summary Summary of gene provided in NCBI Entrez Gene.	KIF18A is a member of the kinesin superfamily of microtubule-associated molecular motors (see MIM 148760) that use hydrolysis of ATP to produce force and movement along microtubules (Luboshits and Benayahu, 2005 [PubMed 15878648]).[supplied by OMIM, Aug 2

Show/Hide all(28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024821	hsa-miR-215-5p	Microarray	19074876
MIRT026687	hsa-miR-192-5p	Microarray	19074876
MIRT1093465	hsa-miR-3115	CLIP-seq
MIRT1093466	hsa-miR-323-3p	CLIP-seq
MIRT1093467	hsa-miR-4699-3p	CLIP-seq
MIRT1093468	hsa-miR-4773	CLIP-seq
MIRT1093469	hsa-miR-548a-5p	CLIP-seq
MIRT1093470	hsa-miR-548ab	CLIP-seq
MIRT1093471	hsa-miR-548ak	CLIP-seq
MIRT1093472	hsa-miR-548b-5p	CLIP-seq
MIRT1093473	hsa-miR-548c-5p	CLIP-seq
MIRT1093474	hsa-miR-548d-5p	CLIP-seq
MIRT1093475	hsa-miR-548h	CLIP-seq
MIRT1093476	hsa-miR-548i	CLIP-seq
MIRT1093477	hsa-miR-548j	CLIP-seq
MIRT1093478	hsa-miR-548k	CLIP-seq
MIRT1093479	hsa-miR-548l	CLIP-seq
MIRT1093480	hsa-miR-548w	CLIP-seq
MIRT1093481	hsa-miR-548y	CLIP-seq
MIRT1093482	hsa-miR-559	CLIP-seq
MIRT1093483	hsa-miR-570	CLIP-seq
MIRT2025073	hsa-miR-758	CLIP-seq
MIRT2256167	hsa-miR-4327	CLIP-seq
MIRT2256168	hsa-miR-4766-5p	CLIP-seq
MIRT2256169	hsa-miR-544	CLIP-seq
MIRT1093478	hsa-miR-548k	CLIP-seq
MIRT2256170	hsa-miR-628-5p	CLIP-seq
MIRT2256171	hsa-miR-890	CLIP-seq

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IBA	21873635
GO:0000776	Component	Kinetochore	IEA
GO:0001726	Component	Ruffle	IDA	17006958
GO:0003777	Function	Microtubule motor activity	IBA	21873635
GO:0003779	Function	Actin binding	IPI	18680169
GO:0005515	Function	Protein binding	IPI	15231748, 17006958, 23288039, 27173435, 28514442
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	17006958, 17346968, 18680169
GO:0005737	Component	Cytoplasm	IDA	17006958, 18680169
GO:0005815	Component	Microtubule organizing center	IEA
GO:0005828	Component	Kinetochore microtubule	IDA	17346968
GO:0005829	Component	Cytosol	TAS
GO:0005871	Component	Kinesin complex	IBA	21873635
GO:0005874	Component	Microtubule	IBA	21873635
GO:0005901	Component	Caveola	IDA	17006958
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS
GO:0007018	Process	Microtubule-based movement	IBA	21873635
GO:0007018	Process	Microtubule-based movement	TAS
GO:0007019	Process	Microtubule depolymerization	IBA	21873635
GO:0007019	Process	Microtubule depolymerization	IDA	17346968
GO:0007080	Process	Mitotic metaphase plate congression	IDA	17346968
GO:0007140	Process	Male meiotic nuclear division	IEA
GO:0008017	Function	Microtubule binding	IBA	21873635
GO:0008017	Function	Microtubule binding	IDA	18680169
GO:0008574	Function	ATP-dependent microtubule motor activity, plus-end-directed	IBA	21873635
GO:0008574	Function	ATP-dependent microtubule motor activity, plus-end-directed	IDA	17346968
GO:0015031	Process	Protein transport	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016887	Function	ATPase activity	IBA	21873635
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS
GO:0051010	Function	Microtubule plus-end binding	IDA	17346968
GO:0061673	Component	Mitotic spindle astral microtubule	IBA	21873635
GO:0070463	Function	Tubulin-dependent ATPase activity	IDA	17346968
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IEA
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0072520	Process	Seminiferous tubule development	IEA
GO:1990023	Component	Mitotic spindle midzone	IBA	21873635

MIM	HGNC	e!Ensembl
611271	29441	ENSG00000121621

Protein

UniProt ID

Q8NI77

Protein name

Kinesin-like protein KIF18A (Marrow stromal KIF18A) (MS-KIF18A)

Protein function

Microtubule-depolymerizing kinesin which plays a role in chromosome congression by reducing the amplitude of preanaphase oscillations and slowing poleward movement during anaphase, thus suppressing chromosome movements. May stabilize the CENPE-B

PDB

3LRE , 5OAM , 5OCU , 5OGC , 7RSI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00225	Kinesin	17 → 355	Kinesin motor domain	Domain

Sequence

MSVTEEDLCHHMKVVVRVRPENTKEKAAGFHKVVHVVDKHILVFDPKQEEVSFFHGKKTT
NQNVIKKQNKDLKFVFDAVFDETSTQSEVFEHTTKPILRSFLNGYNCTVLAYGATGAGKT
HTMLGSADEPGVMYLTMLHLYKCMDEIKEEKICSTAVSYLEVYNEQIRDLLVNSGPLAVR
EDTQKGVVVHGLTLHQPKSSEEILHLLDNGNKNRTQHPTDMNATSSRSHAVFQIYLRQQD
KTASINQNVRIAKMSLIDLAGSERASTSGAKGTRFVEGTNINRSLLALGNVINALADSKR
KNQHIPYRNSKLTRLLKDSLGGNCQTIMIAAVSPSSVFYDDTYNTLKYANRAKDIKSSLK
SNVLNVNNHITQYVKICNEQKAEILLLKEKLKAYEEQKAFTNENDQAKLMISNPQEKEIE
RFQEILNCLFQNREEIRQEYLKLEMLLKENELKSFYQQQCHKQIEMMCSEDKVEKATGKR
DHRLAMLKTRRSYLEKRREEELKQFDENTNWLHRVEKEMGLLSQNGHIPKELKKDLHCHH
LHLQNKDLKAQIRHMMDLACLQEQQHRQTEAVLNALLPTLRKQYCTLKEAGLSNAAFESD
FKEIEHLVERKKVVVWADQTAEQPKQNDLPGISVLMTFPQLGPVQPIPCCSSSGGTNLVK
IPTEKRTRRKLMPSPLKGQHTLKSPPSQSVQLNDSLSKELQPIVYTPEDCRKAFQNPSTV
TLMKPSSFTTSFQAISSNINSDNCLKMLCEVAIPHNRRKECGQEDLDSTFTICEDIKSSK
CKLPEQESLPNDNKDILQRLDPSSFSTKHSMPVPSMVPSYMAMTTAAKRKRKLTSSTSNS
SLTADVNSGFAKRVRQDNSSEKHLQENKPTMEHKRNICKINPSMVRKFGRNISKGNLR

Sequence length

898

Interactions

View interactions

	KEGG		Reactome
	Motor proteins		Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal MHC class II antigen presentation Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion RHO GTPases Activate Formins COPI-dependent Golgi-to-ER retrograde traffic Mitotic Prometaphase EML4 and NUDC in mitotic spindle formation Kinesins

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Bipolar Disorder	Bipolar Disorder	GWAS
Gout	Gout	GWAS
Lymphocytic Leukemia	Lymphocytic Leukemia	GWAS

Show/Hide Text Mining Associations (33)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Stimulate	31977917
Adenocarcinoma of Lung	Associate	30907518
Adrenocortical Carcinoma	Associate	32923148, 36830695
Breast Neoplasms	Associate	30907518, 30961553, 33066779, 33619254, 38195458
Carcinogenesis	Associate	30907518
Carcinoma Hepatocellular	Associate	25431949, 33111935, 36204642, 40255404
Carcinoma Non Small Cell Lung	Associate	31977917
Carcinoma Renal Cell	Associate	30822312, 31948514, 36830695
Chromosomal Instability	Associate	33619254
Colorectal Neoplasms	Associate	33619254
Endometrial Neoplasms	Associate	36830695
Esophageal Neoplasms	Stimulate	33872988
Glioblastoma	Associate	30872592
Glioma	Associate	36830695
Glioma of Brain Familial	Associate	36830695
Hereditary Breast and Ovarian Cancer Syndrome	Associate	38195458
Intestinal Pseudo Obstruction	Associate	30961553
Kidney Neoplasms	Associate	33626918
Lymphatic Metastasis	Associate	25431949
Lymphatic Metastasis	Inhibit	30907518
Lymphatic Metastasis	Stimulate	31977917
Lymphoma Non Hodgkin	Stimulate	30872592
Microsatellite Instability	Associate	36830695
Multiple Myeloma	Associate	28404951
Neoplasm Metastasis	Stimulate	31451680
Neoplasm Metastasis	Associate	38195458
Neoplasms	Associate	24074379, 25431949, 30907518, 30961553, 31451680, 31977917, 33505027, 33505028, 33619254, 33872988, 36830695, 38195458
Pancreatic Neoplasms	Associate	36830695
Prostatic Neoplasms	Associate	31451680
Prostatitis	Associate	31451680
Rufous oculocutaneous albinism	Stimulate	31977917
Thrombosis	Associate	25431949
Uterine Cervical Neoplasms	Associate	33829064

KIF18A (kinesin family member 18A)