Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	81929
Gene name Gene Name - the full gene name approved by the HGNC.	SEH1 like nucleoporin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SEH1L
Synonyms (NCBI Gene) Gene synonyms aliases	SEC13L, SEH1A, SEH1B, Seh1
Chromosome Chromosome number	18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	18p11.21
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is part of a nuclear pore complex, Nup107-160. This protein contains WD repeats and shares 34% amino acid identity with yeast Seh1 and 30% identity with yeast Sec13. All constituents of the Nup107-160 complex, including th

Show/Hide all(240)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003158	hsa-miR-210-3p	immunoprecipitaion, Microarray, qRT-PCR	19826008
MIRT031586	hsa-miR-16-5p	Sequencing	20371350
MIRT622316	hsa-miR-6508-5p	HITS-CLIP	23824327
MIRT622315	hsa-miR-8067	HITS-CLIP	23824327
MIRT622314	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT622313	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT290167	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT346278	hsa-miR-4422	PAR-CLIP	23446348
MIRT290168	hsa-miR-3646	PAR-CLIP	23446348
MIRT290169	hsa-miR-5680	PAR-CLIP	23446348
MIRT468649	hsa-miR-4476	PAR-CLIP	23592263
MIRT468648	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT468647	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT468646	hsa-miR-4487	PAR-CLIP	23592263
MIRT468645	hsa-miR-4533	PAR-CLIP	23592263
MIRT468644	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT468643	hsa-miR-765	PAR-CLIP	23592263
MIRT468642	hsa-miR-4475	PAR-CLIP	23592263
MIRT468641	hsa-miR-3664-3p	PAR-CLIP	23592263
MIRT468640	hsa-miR-1266-5p	PAR-CLIP	23592263
MIRT468639	hsa-miR-4518	PAR-CLIP	23592263
MIRT468638	hsa-miR-6089	PAR-CLIP	23592263
MIRT468637	hsa-miR-6892-5p	PAR-CLIP	23592263
MIRT622316	hsa-miR-6508-5p	HITS-CLIP	23824327
MIRT622315	hsa-miR-8067	HITS-CLIP	23824327
MIRT622314	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT622313	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT290167	hsa-miR-548e-5p	PAR-CLIP	23446348
MIRT346278	hsa-miR-4422	PAR-CLIP	23446348
MIRT290168	hsa-miR-3646	PAR-CLIP	23446348
MIRT290169	hsa-miR-5680	PAR-CLIP	23446348
MIRT468649	hsa-miR-4476	PAR-CLIP	23592263
MIRT468648	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT468647	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT468646	hsa-miR-4487	PAR-CLIP	23592263
MIRT468645	hsa-miR-4533	PAR-CLIP	23592263
MIRT468644	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT468643	hsa-miR-765	PAR-CLIP	23592263
MIRT468642	hsa-miR-4475	PAR-CLIP	23592263
MIRT468641	hsa-miR-3664-3p	PAR-CLIP	23592263
MIRT468640	hsa-miR-1266-5p	PAR-CLIP	23592263
MIRT468639	hsa-miR-4518	PAR-CLIP	23592263
MIRT468638	hsa-miR-6089	PAR-CLIP	23592263
MIRT468637	hsa-miR-6892-5p	PAR-CLIP	23592263
MIRT1333959	hsa-miR-128	CLIP-seq
MIRT1333960	hsa-miR-141	CLIP-seq
MIRT1333961	hsa-miR-154	CLIP-seq
MIRT1333962	hsa-miR-200a	CLIP-seq
MIRT1333963	hsa-miR-2054	CLIP-seq
MIRT1333964	hsa-miR-23a	CLIP-seq
MIRT1333965	hsa-miR-23b	CLIP-seq
MIRT1333966	hsa-miR-23c	CLIP-seq
MIRT1333967	hsa-miR-27a	CLIP-seq
MIRT1333968	hsa-miR-27b	CLIP-seq
MIRT1333969	hsa-miR-3160-5p	CLIP-seq
MIRT1333970	hsa-miR-323b-5p	CLIP-seq
MIRT1333971	hsa-miR-3616-5p	CLIP-seq
MIRT1333972	hsa-miR-3647-5p	CLIP-seq
MIRT1333973	hsa-miR-374c	CLIP-seq
MIRT1333974	hsa-miR-4318	CLIP-seq
MIRT1333975	hsa-miR-4520a-3p	CLIP-seq
MIRT1333976	hsa-miR-4520b-3p	CLIP-seq
MIRT1333977	hsa-miR-4662a-5p	CLIP-seq
MIRT1333978	hsa-miR-4676-5p	CLIP-seq
MIRT1333979	hsa-miR-4693-5p	CLIP-seq
MIRT1333980	hsa-miR-4742-3p	CLIP-seq
MIRT1333981	hsa-miR-4778-5p	CLIP-seq
MIRT1333982	hsa-miR-513a-5p	CLIP-seq
MIRT1333983	hsa-miR-573	CLIP-seq
MIRT1333984	hsa-miR-575	CLIP-seq
MIRT1333985	hsa-miR-622	CLIP-seq
MIRT1333986	hsa-miR-630	CLIP-seq
MIRT1333987	hsa-miR-655	CLIP-seq
MIRT1333988	hsa-miR-890	CLIP-seq
MIRT1333989	hsa-miR-892a	CLIP-seq
MIRT1333990	hsa-miR-106a	CLIP-seq
MIRT1333991	hsa-miR-106b	CLIP-seq
MIRT1333992	hsa-miR-150	CLIP-seq
MIRT1333993	hsa-miR-17	CLIP-seq
MIRT1333994	hsa-miR-1914	CLIP-seq
MIRT1333995	hsa-miR-20a	CLIP-seq
MIRT1333996	hsa-miR-20b	CLIP-seq
MIRT1333997	hsa-miR-2110	CLIP-seq
MIRT1333967	hsa-miR-27a	CLIP-seq
MIRT1333968	hsa-miR-27b	CLIP-seq
MIRT1333998	hsa-miR-28-5p	CLIP-seq
MIRT1333999	hsa-miR-3139	CLIP-seq
MIRT1334000	hsa-miR-3179	CLIP-seq
MIRT1334001	hsa-miR-3202	CLIP-seq
MIRT1334002	hsa-miR-3609	CLIP-seq
MIRT1334003	hsa-miR-3653	CLIP-seq
MIRT1334004	hsa-miR-3658	CLIP-seq
MIRT1334005	hsa-miR-3672	CLIP-seq
MIRT1334006	hsa-miR-3689a-3p	CLIP-seq
MIRT1334007	hsa-miR-3689c	CLIP-seq
MIRT1334008	hsa-miR-3938	CLIP-seq
MIRT1334009	hsa-miR-4271	CLIP-seq
MIRT1334010	hsa-miR-4315	CLIP-seq
MIRT1334011	hsa-miR-4330	CLIP-seq
MIRT1334012	hsa-miR-4667-3p	CLIP-seq
MIRT1334013	hsa-miR-4667-5p	CLIP-seq
MIRT1334014	hsa-miR-4700-5p	CLIP-seq
MIRT1334015	hsa-miR-4725-3p	CLIP-seq
MIRT1334016	hsa-miR-4731-5p	CLIP-seq
MIRT1334017	hsa-miR-4747-5p	CLIP-seq
MIRT1334018	hsa-miR-4790-3p	CLIP-seq
MIRT1334019	hsa-miR-4790-5p	CLIP-seq
MIRT1334020	hsa-miR-4796-3p	CLIP-seq
MIRT1334021	hsa-miR-4802-3p	CLIP-seq
MIRT1334022	hsa-miR-510	CLIP-seq
MIRT1334023	hsa-miR-512-5p	CLIP-seq
MIRT1333982	hsa-miR-513a-5p	CLIP-seq
MIRT1334024	hsa-miR-519d	CLIP-seq
MIRT1334025	hsa-miR-526b	CLIP-seq
MIRT1334026	hsa-miR-548ah	CLIP-seq
MIRT1334027	hsa-miR-587	CLIP-seq
MIRT1334028	hsa-miR-606	CLIP-seq
MIRT1334029	hsa-miR-708	CLIP-seq
MIRT1334030	hsa-miR-93	CLIP-seq
MIRT2098802	hsa-miR-1283	CLIP-seq
MIRT1333960	hsa-miR-141	CLIP-seq
MIRT1333962	hsa-miR-200a	CLIP-seq
MIRT1333963	hsa-miR-2054	CLIP-seq
MIRT1333967	hsa-miR-27a	CLIP-seq
MIRT1333968	hsa-miR-27b	CLIP-seq
MIRT2098803	hsa-miR-3166	CLIP-seq
MIRT2098804	hsa-miR-3182	CLIP-seq
MIRT1333970	hsa-miR-323b-5p	CLIP-seq
MIRT1333973	hsa-miR-374c	CLIP-seq
MIRT1334011	hsa-miR-4330	CLIP-seq
MIRT2098805	hsa-miR-4643	CLIP-seq
MIRT2098806	hsa-miR-4696	CLIP-seq
MIRT1333980	hsa-miR-4742-3p	CLIP-seq
MIRT2098807	hsa-miR-4766-5p	CLIP-seq
MIRT2098808	hsa-miR-4771	CLIP-seq
MIRT1333981	hsa-miR-4778-5p	CLIP-seq
MIRT2098809	hsa-miR-4794	CLIP-seq
MIRT1333982	hsa-miR-513a-5p	CLIP-seq
MIRT2098810	hsa-miR-548c-3p	CLIP-seq
MIRT2098811	hsa-miR-548g	CLIP-seq
MIRT2098812	hsa-miR-548p	CLIP-seq
MIRT1333986	hsa-miR-630	CLIP-seq
MIRT1333987	hsa-miR-655	CLIP-seq
MIRT2323550	hsa-miR-105	CLIP-seq
MIRT2323551	hsa-miR-1244	CLIP-seq
MIRT2098802	hsa-miR-1283	CLIP-seq
MIRT2323552	hsa-miR-132	CLIP-seq
MIRT2323553	hsa-miR-138	CLIP-seq
MIRT2323554	hsa-miR-145	CLIP-seq
MIRT1333961	hsa-miR-154	CLIP-seq
MIRT2323555	hsa-miR-15a	CLIP-seq
MIRT2323556	hsa-miR-15b	CLIP-seq
MIRT2323557	hsa-miR-16	CLIP-seq
MIRT2323558	hsa-miR-194	CLIP-seq
MIRT2323559	hsa-miR-195	CLIP-seq
MIRT2323560	hsa-miR-200b	CLIP-seq
MIRT2323561	hsa-miR-200c	CLIP-seq
MIRT2323562	hsa-miR-208a	CLIP-seq
MIRT2323563	hsa-miR-208b	CLIP-seq
MIRT1333997	hsa-miR-2110	CLIP-seq
MIRT2323564	hsa-miR-212	CLIP-seq
MIRT1333998	hsa-miR-28-5p	CLIP-seq
MIRT2323565	hsa-miR-3120-3p	CLIP-seq
MIRT2323566	hsa-miR-3121-5p	CLIP-seq
MIRT2323567	hsa-miR-3130-5p	CLIP-seq
MIRT1333999	hsa-miR-3139	CLIP-seq
MIRT2323568	hsa-miR-3145-5p	CLIP-seq
MIRT2323569	hsa-miR-3163	CLIP-seq
MIRT2098803	hsa-miR-3166	CLIP-seq
MIRT1334000	hsa-miR-3179	CLIP-seq
MIRT2098804	hsa-miR-3182	CLIP-seq
MIRT1334001	hsa-miR-3202	CLIP-seq
MIRT2323570	hsa-miR-3662	CLIP-seq
MIRT2323571	hsa-miR-369-3p	CLIP-seq
MIRT2323572	hsa-miR-3925-3p	CLIP-seq
MIRT2323573	hsa-miR-3974	CLIP-seq
MIRT2323574	hsa-miR-424	CLIP-seq
MIRT2323575	hsa-miR-4269	CLIP-seq
MIRT1334009	hsa-miR-4271	CLIP-seq
MIRT2323576	hsa-miR-4282	CLIP-seq
MIRT2323577	hsa-miR-429	CLIP-seq
MIRT2323578	hsa-miR-4326	CLIP-seq
MIRT2323579	hsa-miR-4432	CLIP-seq
MIRT2323580	hsa-miR-4436a	CLIP-seq
MIRT2323581	hsa-miR-4482	CLIP-seq
MIRT1333975	hsa-miR-4520a-3p	CLIP-seq
MIRT1333976	hsa-miR-4520b-3p	CLIP-seq
MIRT1334013	hsa-miR-4667-5p	CLIP-seq
MIRT2323582	hsa-miR-4690-5p	CLIP-seq
MIRT2323583	hsa-miR-4700-3p	CLIP-seq
MIRT1334014	hsa-miR-4700-5p	CLIP-seq
MIRT2323584	hsa-miR-4720-3p	CLIP-seq
MIRT1334015	hsa-miR-4725-3p	CLIP-seq
MIRT1334016	hsa-miR-4731-5p	CLIP-seq
MIRT1334017	hsa-miR-4747-5p	CLIP-seq
MIRT2323585	hsa-miR-4761-5p	CLIP-seq
MIRT2323586	hsa-miR-4762-5p	CLIP-seq
MIRT2098807	hsa-miR-4766-5p	CLIP-seq
MIRT2098808	hsa-miR-4771	CLIP-seq
MIRT2323587	hsa-miR-4773	CLIP-seq
MIRT2098809	hsa-miR-4794	CLIP-seq
MIRT2323588	hsa-miR-4804-3p	CLIP-seq
MIRT2323589	hsa-miR-490-3p	CLIP-seq
MIRT2323590	hsa-miR-494	CLIP-seq
MIRT2323591	hsa-miR-497	CLIP-seq
MIRT2323592	hsa-miR-499-5p	CLIP-seq
MIRT2323593	hsa-miR-508-5p	CLIP-seq
MIRT2323594	hsa-miR-5095	CLIP-seq
MIRT2323595	hsa-miR-545	CLIP-seq
MIRT2098810	hsa-miR-548c-3p	CLIP-seq
MIRT2098811	hsa-miR-548g	CLIP-seq
MIRT2098812	hsa-miR-548p	CLIP-seq
MIRT1334027	hsa-miR-587	CLIP-seq
MIRT2323596	hsa-miR-607	CLIP-seq
MIRT2323597	hsa-miR-649	CLIP-seq
MIRT1334029	hsa-miR-708	CLIP-seq
MIRT2323598	hsa-miR-873	CLIP-seq
MIRT2323599	hsa-miR-888	CLIP-seq
MIRT1333988	hsa-miR-890	CLIP-seq
MIRT1333961	hsa-miR-154	CLIP-seq
MIRT2323566	hsa-miR-3121-5p	CLIP-seq
MIRT2323567	hsa-miR-3130-5p	CLIP-seq
MIRT2098803	hsa-miR-3166	CLIP-seq
MIRT2323578	hsa-miR-4326	CLIP-seq
MIRT2323581	hsa-miR-4482	CLIP-seq
MIRT2098808	hsa-miR-4771	CLIP-seq
MIRT1333959	hsa-miR-128	CLIP-seq
MIRT1333967	hsa-miR-27a	CLIP-seq
MIRT1333968	hsa-miR-27b	CLIP-seq
MIRT1333974	hsa-miR-4318	CLIP-seq
MIRT1333979	hsa-miR-4693-5p	CLIP-seq
MIRT1333982	hsa-miR-513a-5p	CLIP-seq
MIRT1333989	hsa-miR-892a	CLIP-seq
MIRT1333959	hsa-miR-128	CLIP-seq
MIRT1333967	hsa-miR-27a	CLIP-seq
MIRT1333968	hsa-miR-27b	CLIP-seq
MIRT1333974	hsa-miR-4318	CLIP-seq
MIRT1333979	hsa-miR-4693-5p	CLIP-seq
MIRT1333982	hsa-miR-513a-5p	CLIP-seq
MIRT1333989	hsa-miR-892a	CLIP-seq

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000776	Component	Kinetochore	IDA	15146057, 17363900
GO:0000777	Component	Condensed chromosome kinetochore	IEA
GO:0005198	Function	Structural molecule activity	IEA
GO:0005515	Function	Protein binding	IPI	24315095, 26391640, 26496610, 26972053, 27194810
GO:0005635	Component	Nuclear envelope	TAS
GO:0005765	Component	Lysosomal membrane	IDA	28199306
GO:0005829	Component	Cytosol	TAS
GO:0006110	Process	Regulation of glycolytic process	TAS
GO:0006406	Process	MRNA export from nucleus	TAS
GO:0006409	Process	TRNA export from nucleus	TAS
GO:0006999	Process	Nuclear pore organization	IMP	15146057
GO:0007080	Process	Mitotic metaphase plate congression	IMP	17363900
GO:0016032	Process	Viral process	TAS
GO:0016925	Process	Protein sumoylation	TAS
GO:0019083	Process	Viral transcription	TAS
GO:0031080	Component	Nuclear pore outer ring	IBA	21873635
GO:0031080	Component	Nuclear pore outer ring	IDA	17360435
GO:0031080	Component	Nuclear pore outer ring	NAS	15146057, 17363900
GO:0032008	Process	Positive regulation of TOR signaling	IMP	23723238
GO:0034198	Process	Cellular response to amino acid starvation	IBA	21873635
GO:0034198	Process	Cellular response to amino acid starvation	IMP	23723238
GO:0034629	Process	Cellular protein-containing complex localization	IMP	23723238
GO:0035859	Component	Seh1-associated complex	IBA	21873635
GO:0043657	Component	Host cell	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0051301	Process	Cell division	IEA
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IMP	17363900
GO:0060964	Process	Regulation of gene silencing by miRNA	TAS
GO:0061700	Component	GATOR2 complex	IDA	23723238
GO:0075733	Process	Intracellular transport of virus	TAS
GO:1900034	Process	Regulation of cellular response to heat	TAS
GO:1904263	Process	Positive regulation of TORC1 signaling	IBA	21873635
GO:1904263	Process	Positive regulation of TORC1 signaling	IMP	25457612

MIM	HGNC	e!Ensembl
609263	30379	ENSG00000085415

Protein

UniProt ID

Q96EE3

Protein name

Nucleoporin SEH1 (GATOR2 complex protein SEH1) (Nup107-160 subcomplex subunit SEH1) (SEC13-like protein)

Protein function

Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC (PubMed:15146057, PubMed:17363900). The Nup107-160 subcomplex is also required for normal kineto

PDB

5A9Q , 7PEQ , 7R5J , 7R5K , 7UHY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00400	WD40	5 → 40	WD domain, G-beta repeat	Repeat
PF00400	WD40	268 → 306	WD domain, G-beta repeat	Repeat

Sequence

MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSV
WRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVK
FAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSP
MIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAI
ATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDG
CVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRKHS

Sequence length

360

Interactions

View interactions

	KEGG		Reactome
	Nucleocytoplasmic transport mTOR signaling pathway Amyotrophic lateral sclerosis		ISG15 antiviral mechanism Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal Transport of the SLBP independent Mature mRNA Transport of the SLBP Dependant Mature mRNA Transport of Mature mRNA Derived from an Intronless Transcript Transport of Mature mRNA derived from an Intron-Containing Transcript Rev-mediated nuclear export of HIV RNA Transport of Ribonucleoproteins into the Host Nucleus NS1 Mediated Effects on Host Pathways Viral Messenger RNA Synthesis NEP/NS2 Interacts with the Cellular Export Machinery Regulation of Glucokinase by Glucokinase Regulatory Protein Vpr-mediated nuclear import of PICs snRNP Assembly Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion SUMOylation of DNA damage response and repair proteins SUMOylation of ubiquitinylation proteins Nuclear Pore Complex (NPC) Disassembly Regulation of HSF1-mediated heat shock response SUMOylation of SUMOylation proteins SUMOylation of chromatin organization proteins SUMOylation of RNA binding proteins SUMOylation of DNA replication proteins Transcriptional regulation by small RNAs Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC) RHO GTPases Activate Formins tRNA processing in the nucleus Mitotic Prometaphase HCMV Early Events HCMV Late Events Postmitotic nuclear pore complex (NPC) reformation Amino acids regulate mTORC1 EML4 and NUDC in mitotic spindle formation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	31374203

SEH1L (SEH1 like nucleoporin)