Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
81887
Gene name Gene Name - the full gene name approved by the HGNC.
LAS1 like ribosome biogenesis factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LAS1L
Synonyms (NCBI Gene) Gene synonyms aliases
Las1, Las1-like, MRXSWTS, WTS, dJ475B7.2
Disease Acronyms (UniProt) Disease acronyms from UniProt database
WTS
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq12
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs797044926 C>T Likely-pathogenic Missense variant, non coding transcript variant, coding sequence variant
rs1057518699 G>A Likely-pathogenic Missense variant, coding sequence variant, non coding transcript variant
rs1057522039 G>A Likely-pathogenic Coding sequence variant, stop gained, genic downstream transcript variant, non coding transcript variant
rs1602612611 C>T Likely-pathogenic Coding sequence variant, non coding transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022244 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT051007 hsa-miR-17-5p CLASH 23622248
MIRT1104955 hsa-miR-181a CLIP-seq
MIRT1104956 hsa-miR-181b CLIP-seq
MIRT1104957 hsa-miR-181c CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000460 Process Maturation of 5.8S rRNA IBA 21873635
GO:0000470 Process Maturation of LSU-rRNA IBA 21873635
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0004519 Function Endonuclease activity IEA
GO:0005515 Function Protein binding IPI 22046132
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300964 25726 ENSG00000001497
Protein
UniProt ID Q9Y4W2
Protein name Ribosomal biogenesis protein LAS1L (Endoribonuclease LAS1L) (EC 3.1.-.-) (Protein LAS1 homolog)
Protein function Required for the synthesis of the 60S ribosomal subunit and maturation of the 28S rRNA (PubMed:20647540). Functions as a component of the Five Friends of Methylated CHTOP (5FMC) complex; the 5FMC complex is recruited to ZNF148 by methylated CHTO
PDB 8FL2 , 8FL3 , 8FL4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04031 Las1 43 187 Las1-like Family
Sequence
MSWESGAGPGLGSQGMDLVWSAWYGKCVKGKGSLPLSAHGIVVAWLSRAEWDQVTVYLFC
DDHKLQRYALNRITVWRSRSGNELPLAVASTADLIRCKLLDVTGGLGTDELRLLYGMALV
RFVNLISERKTKFAKVPLKCLAQEVNIPDWIVDLRHELTHKKMPHINDCRRGCYFVLDWL
QKTYWCR
QLENSLRETWELEEFREGIEEEDQEEDKNIVVDDITEQKPEPQDDGKSTESDV
KADGDSKGSEEVDSHCKKALSHKELYERARELLVSYEEEQFTVLEKFRYLPKAIKAWNNP
SPRVECVLAELKGVTCENREAVLDAFLDDGFLVPTFEQLAALQIEYEDGQTEVQRGEGTD
PKSHKNVDLNDVLVPKPFSQFWQPLLRGLHSQNFTQALLERMLSELPALGISGIRPTYIL
RWTVELIVANTKTGRNARRFSAGQWEARRGWRLFNCSASLDWPRMVESCLGSPCWASPQL
LRIIFKAMGQGLPDEEQEKLLRICSIYTQSGENSLVQEGSEASPIGKSPYTLDSLYWSVK
PASSSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEEDEDDEDD
EEEDRMEVGPFSTGQESPTAENARLLAQKRGALQGSAWQVSSEDVRWDTFPLGRMPGQTE
DPAELMLENYDTMYLLDQPVLEQRLEPSTCKTDTLGLSCGVGSGNCSNSSSSNFEGLLWS
QGQLHGLKTGLQLF
Sequence length 734
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Major pathway of rRNA processing in the nucleolus and cytosol
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Cryptorchidism Cryptorchidism rs121912555, rs104894697, rs104894698, rs398122886
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
25644381
Hypogonadotropic hypogonadism Hypogonadotropic hypogonadism rs104894702, rs104893836, rs104893837, rs104893842, rs121909628, rs138249161, rs1601946139
Unknown
Disease term Disease name Evidence References Source
Specific learning disorder Specific learning disability ClinVar
Spinal Muscular Atrophy With Respiratory Distress spinal muscular atrophy with respiratory distress type 2 GenCC
Hypogonadism Hypogonadism GWAS
Insomnia Insomnia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 32193494
Beta ketothiolase deficiency Associate 35627110
Dyspnea Associate 35627110
Intellectual Disability Associate 31288032
Mental Retardation X Linked Syndromic Christianson Type Associate 34653234
Motor Neuron Disease Associate 31288032
Muscle Hypotonia Associate 35627110
Respiratory Insufficiency Associate 35627110
Severe infantile axonal neuropathy Associate 35627110
Spinal muscular atrophy with respiratory distress 1 Associate 35627110