ZNF239 (zinc finger protein 239)

Gene

• Entrez ID: 8187
• Gene name: Zinc finger protein 239
• Gene symbol: ZNF239
• Synonyms (NCBI Gene): HOK-2, MOK2
• Chromosome: 10
• Chromosome location: 10q11.21
• Summary: MOK2 proteins are DNA- and RNA-binding proteins that are mainly associated with nuclear RNP components, including the nucleoli and extranucleolar structures (Arranz et al., 1997 [PubMed 9121460]).[supplied by OMIM, Mar 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT043876	hsa-miR-378a-3p	CLASH	23622248
MIRT571263	hsa-miR-4282	PAR-CLIP	20371350
MIRT571262	hsa-miR-4709-3p	PAR-CLIP	20371350
MIRT571263	hsa-miR-4282	PAR-CLIP	20371350
MIRT571262	hsa-miR-4709-3p	PAR-CLIP	20371350
MIRT571263	hsa-miR-4282	PAR-CLIP	20371350
MIRT571262	hsa-miR-4709-3p	PAR-CLIP	20371350
MIRT571263	hsa-miR-4282	PAR-CLIP	20371350
MIRT571262	hsa-miR-4709-3p	PAR-CLIP	20371350
MIRT1518940	hsa-miR-3120-3p	CLIP-seq
MIRT1518941	hsa-miR-4289	CLIP-seq
MIRT1518942	hsa-miR-664	CLIP-seq
MIRT1518943	hsa-miR-3123	CLIP-seq
MIRT1518944	hsa-miR-3919	CLIP-seq
MIRT1518945	hsa-miR-4330	CLIP-seq
MIRT1518946	hsa-miR-4756-3p	CLIP-seq
MIRT1518941	hsa-miR-4289	CLIP-seq
MIRT2668617	hsa-miR-3126-5p	CLIP-seq
MIRT2668618	hsa-miR-4276	CLIP-seq
MIRT2668619	hsa-miR-4419a	CLIP-seq
MIRT2668620	hsa-miR-4510	CLIP-seq
MIRT2668621	hsa-miR-4765	CLIP-seq
MIRT2668622	hsa-miR-4799-5p	CLIP-seq
MIRT2668618	hsa-miR-4276	CLIP-seq
MIRT2668621	hsa-miR-4765	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11278819
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	11278819
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	11278819
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IMP	11278819
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	9121460
GO:0003723	Function	RNA binding	TAS	9121460
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 601069
• HGNC: 13031
• e!Ensembl: ENSG00000196793

Protein

• UniProt ID: Q16600
• Protein name: Zinc finger protein 239 (Zinc finger protein HOK-2) (Zinc finger protein MOK-2)
• Protein function: May be involved in transcriptional regulation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	207 → 229	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	235 → 257	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	263 → 285	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	291 → 313	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	319 → 341	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	347 → 369	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	375 → 397	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	403 → 425	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	431 → 453	Zinc finger, C2H2 type	Domain

• Sequence:

  MASTITGSQDCIVNHRGEVDGEPELDISPCQQWGEASSPISRNRDSVMTLQSGCFENIES
  ETYLPLKVSSQIDTQDSSVKFCKNEPQDHQESRRLFVMEESTERKVIKGESCSENLQVKL
  VSDGQELASPLLNGEATCQNGQLKESLDPIDCNCKDIHGWKSQVVSCSQQRAHTEEKPCD
  HNNCGKILNTSPDGHPYEKIHTAEKQYECSQCGKNFSQSSELLLHQRDHTEEKPYKCEQC
  GKGFTRSSSLLIHQAVHTDEKPYKCDKCGKGFTRSSSLLIHHAVHTGEKPYKCDKCGKGF
  SQSSKLHIHQRVHTGEKPYECEECGMSFSQRSNLHIHQRVHTGERPYKCGECGKGFSQSS
  NLHIHRCIHTGEKPYQCYECGKGFSQSSDLRIHLRVHTGEKPYHCGKCGKGFSQSSKLLI
  HQRVHTGEKPYECSKCGKGFSQSSNLHIHQRVHKKDPR

• Sequence length: 458

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Carcinoma Hepatocellular	Associate	33297932	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	24968322	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	22529894	★☆☆☆☆ Found in Text Mining only