Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	81853
Gene name	Transmembrane protein 14B
Gene symbol	TMEM14B
Synonyms (NCBI Gene)	-
Chromosome	6
Chromosome location	6p24.2

104

Show/Hide all (104)

miRTarBase ID	miRNA	Experiments
MIRT1431381	hsa-miR-1245b-3p	CLIP-seq
MIRT1431382	hsa-miR-1470	CLIP-seq
MIRT1431383	hsa-miR-3143	CLIP-seq
MIRT1431384	hsa-miR-3145-3p	CLIP-seq
MIRT1431385	hsa-miR-331-5p	CLIP-seq
MIRT1431386	hsa-miR-3662	CLIP-seq
MIRT1431387	hsa-miR-3692	CLIP-seq
MIRT1431388	hsa-miR-374c	CLIP-seq
MIRT1431389	hsa-miR-3973	CLIP-seq
MIRT1431390	hsa-miR-4325	CLIP-seq
MIRT1431391	hsa-miR-4711-3p	CLIP-seq
MIRT1431392	hsa-miR-4753-3p	CLIP-seq
MIRT1431393	hsa-miR-4768-5p	CLIP-seq
MIRT1431394	hsa-miR-4793-3p	CLIP-seq
MIRT1431395	hsa-miR-4803	CLIP-seq
MIRT1431396	hsa-miR-511	CLIP-seq
MIRT1431397	hsa-miR-520g	CLIP-seq
MIRT1431398	hsa-miR-520h	CLIP-seq
MIRT1431399	hsa-miR-607	CLIP-seq
MIRT1431400	hsa-miR-622	CLIP-seq
MIRT1431401	hsa-miR-655	CLIP-seq
MIRT1431383	hsa-miR-3143	CLIP-seq
MIRT1554889	hsa-miR-4780	CLIP-seq
MIRT1554890	hsa-miR-543	CLIP-seq
MIRT1431383	hsa-miR-3143	CLIP-seq
MIRT1431388	hsa-miR-374c	CLIP-seq
MIRT2129297	hsa-miR-4311	CLIP-seq
MIRT1431392	hsa-miR-4753-3p	CLIP-seq
MIRT1431393	hsa-miR-4768-5p	CLIP-seq
MIRT1554889	hsa-miR-4780	CLIP-seq
MIRT1554890	hsa-miR-543	CLIP-seq
MIRT1431401	hsa-miR-655	CLIP-seq
MIRT2129297	hsa-miR-4311	CLIP-seq
MIRT2350847	hsa-miR-1208	CLIP-seq
MIRT1431383	hsa-miR-3143	CLIP-seq
MIRT2350848	hsa-miR-377	CLIP-seq
MIRT2350849	hsa-miR-3921	CLIP-seq
MIRT1431389	hsa-miR-3973	CLIP-seq
MIRT2350850	hsa-miR-4303	CLIP-seq
MIRT1431390	hsa-miR-4325	CLIP-seq
MIRT2350851	hsa-miR-4326	CLIP-seq
MIRT2350852	hsa-miR-4426	CLIP-seq
MIRT2350853	hsa-miR-4468	CLIP-seq
MIRT2350854	hsa-miR-4647	CLIP-seq
MIRT2350855	hsa-miR-4653-5p	CLIP-seq
MIRT2350856	hsa-miR-4662b	CLIP-seq
MIRT1554889	hsa-miR-4780	CLIP-seq
MIRT1431394	hsa-miR-4793-3p	CLIP-seq
MIRT1431395	hsa-miR-4803	CLIP-seq
MIRT2350857	hsa-miR-5096	CLIP-seq
MIRT1431397	hsa-miR-520g	CLIP-seq
MIRT1431398	hsa-miR-520h	CLIP-seq
MIRT1554890	hsa-miR-543	CLIP-seq
MIRT2350858	hsa-miR-548p	CLIP-seq
MIRT2350859	hsa-miR-601	CLIP-seq
MIRT1431399	hsa-miR-607	CLIP-seq
MIRT1431400	hsa-miR-622	CLIP-seq
MIRT2395934	hsa-miR-3127-5p	CLIP-seq
MIRT1431383	hsa-miR-3143	CLIP-seq
MIRT1431389	hsa-miR-3973	CLIP-seq
MIRT1554889	hsa-miR-4780	CLIP-seq
MIRT1431395	hsa-miR-4803	CLIP-seq
MIRT2395935	hsa-miR-513c	CLIP-seq
MIRT2395936	hsa-miR-514b-5p	CLIP-seq
MIRT1431397	hsa-miR-520g	CLIP-seq
MIRT1431398	hsa-miR-520h	CLIP-seq
MIRT1554890	hsa-miR-543	CLIP-seq
MIRT1431399	hsa-miR-607	CLIP-seq
MIRT1431383	hsa-miR-3143	CLIP-seq
MIRT1431389	hsa-miR-3973	CLIP-seq
MIRT1431395	hsa-miR-4803	CLIP-seq
MIRT1431397	hsa-miR-520g	CLIP-seq
MIRT1431398	hsa-miR-520h	CLIP-seq
MIRT1431399	hsa-miR-607	CLIP-seq
MIRT1431400	hsa-miR-622	CLIP-seq
MIRT1431383	hsa-miR-3143	CLIP-seq
MIRT1554889	hsa-miR-4780	CLIP-seq
MIRT1554890	hsa-miR-543	CLIP-seq
MIRT2644494	hsa-miR-1178	CLIP-seq
MIRT2644495	hsa-miR-1272	CLIP-seq
MIRT2644496	hsa-miR-1322	CLIP-seq
MIRT1431382	hsa-miR-1470	CLIP-seq
MIRT2644497	hsa-miR-197	CLIP-seq
MIRT2644498	hsa-miR-296-3p	CLIP-seq
MIRT2644499	hsa-miR-300	CLIP-seq
MIRT2644500	hsa-miR-3137	CLIP-seq
MIRT1431383	hsa-miR-3143	CLIP-seq
MIRT2644501	hsa-miR-3163	CLIP-seq
MIRT2644502	hsa-miR-3675-3p	CLIP-seq
MIRT1431387	hsa-miR-3692	CLIP-seq
MIRT2644503	hsa-miR-374a	CLIP-seq
MIRT2644504	hsa-miR-374b	CLIP-seq
MIRT2644505	hsa-miR-381	CLIP-seq
MIRT2129297	hsa-miR-4311	CLIP-seq
MIRT2644506	hsa-miR-4666-3p	CLIP-seq
MIRT2644507	hsa-miR-4666-5p	CLIP-seq
MIRT2644508	hsa-miR-4668-3p	CLIP-seq
MIRT1554889	hsa-miR-4780	CLIP-seq
MIRT1554890	hsa-miR-543	CLIP-seq
MIRT2644509	hsa-miR-577	CLIP-seq
MIRT1431383	hsa-miR-3143	CLIP-seq
MIRT2129297	hsa-miR-4311	CLIP-seq
MIRT1554889	hsa-miR-4780	CLIP-seq
MIRT1554890	hsa-miR-543	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	29033352, 32296183, 36217029
GO:0006783	Process	Heme biosynthetic process	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0016020	Component	Membrane	IEA
GO:0021987	Process	Cerebral cortex development	IMP	29033352
GO:0031966	Component	Mitochondrial membrane	IBA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0061351	Process	Neural precursor cell proliferation	IDA	29033352
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IDA	29033352

MIM	HGNC	e!Ensembl
619865	21384	ENSG00000137210

Q9NUH8

Protein name

Transmembrane protein 14B

Protein function

Primate-specific protein involved in cortical expansion and folding in the developing neocortex. May drive neural progenitor proliferation through nuclear translocation of IQGAP1, which in turn promotes G1/S cell cycle transitions. {ECO:0000269|

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03647	Tmemb_14	13 → 105	Transmembrane proteins 14C	Family

Tissue specificity

TISSUE SPECIFICITY: Mainly expressed in the outer subventricular zone (OSVZ) of the fetal brains. {ECO:0000269|PubMed:29033352}.

Sequence

MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAGLGAYQLYQDP
RNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD

Sequence length

114

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPARATHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OTOSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARATHYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	37380717	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	36037157	★★★★★ ★☆☆☆☆ Found in Text Mining only

TMEM14B (transmembrane protein 14B)