Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	81849
Gene name Gene Name - the full gene name approved by the HGNC.	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ST6GALNAC5
Synonyms (NCBI Gene) Gene synonyms aliases	SIAT7-E, SIAT7E, ST6GalNAcV
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p31.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a Golgi type II transmembrane glycosyltransferase. The encoded protein catalyzes the transfer of sialic acid to cell surface proteins to modulate cell-cell interactions. Several transcript variants encoding different is

Show/Hide all(25)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019483	hsa-miR-148b-3p	Microarray	17612493
MIRT725137	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT725136	hsa-miR-3688-3p	HITS-CLIP	19536157
MIRT725135	hsa-miR-5093	HITS-CLIP	19536157
MIRT725137	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT725136	hsa-miR-3688-3p	HITS-CLIP	19536157
MIRT725135	hsa-miR-5093	HITS-CLIP	19536157
MIRT1393771	hsa-miR-1276	CLIP-seq
MIRT1393772	hsa-miR-219-2-3p	CLIP-seq
MIRT1393773	hsa-miR-2278	CLIP-seq
MIRT1393774	hsa-miR-2964a-3p	CLIP-seq
MIRT1393775	hsa-miR-3130-3p	CLIP-seq
MIRT1393776	hsa-miR-4328	CLIP-seq
MIRT1393777	hsa-miR-4680-3p	CLIP-seq
MIRT1393778	hsa-miR-4793-3p	CLIP-seq
MIRT1393779	hsa-miR-520d-5p	CLIP-seq
MIRT1393780	hsa-miR-524-5p	CLIP-seq
MIRT1393781	hsa-miR-544	CLIP-seq
MIRT2118218	hsa-miR-576-3p	CLIP-seq
MIRT2340200	hsa-miR-3140-3p	CLIP-seq
MIRT2340201	hsa-miR-377	CLIP-seq
MIRT2340202	hsa-miR-4789-3p	CLIP-seq
MIRT1393779	hsa-miR-520d-5p	CLIP-seq
MIRT1393780	hsa-miR-524-5p	CLIP-seq
MIRT1393781	hsa-miR-544	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0001574	Process	Ganglioside biosynthetic process	IBA	21873635
GO:0001665	Function	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IBA	21873635
GO:0001665	Function	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	ISS
GO:0006486	Process	Protein glycosylation	IEA
GO:0006688	Process	Glycosphingolipid biosynthetic process	ISS
GO:0008373	Function	Sialyltransferase activity	ISS	12668675
GO:0009311	Process	Oligosaccharide metabolic process	IBA	21873635
GO:0009312	Process	Oligosaccharide biosynthetic process	ISS	12668675
GO:0016021	Component	Integral component of membrane	IEA
GO:0097503	Process	Sialylation	IEA

MIM	HGNC	e!Ensembl
610134	19342	ENSG00000117069

Protein

UniProt ID

Q9BVH7

Protein name

Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 (EC 2.4.99.-) (GD1 alpha synthase) (GalNAc alpha-2,6-sialyltransferase V) (ST6GalNAc V) (ST6GalNAcV) (Sialyltransferase 7E) (SIAT7-E)

Protein function

Predominantly catalyzes the biosynthesis of ganglioside GD1alpha from GM1b in the brain, by transferring the sialyl group (N-acetyl-alpha-neuraminyl or NeuAc) from CMP-NeuAc to the GalNAc residue on the NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc sequen

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00777	Glyco_transf_29	79 → 317	Glycosyltransferase family 29 (sialyltransferase)	Family

Sequence

MKTLMRHGLAVCLALTTMCTSLLLVYSSLGGQKERPPQQQQQQQQQQQQASATGSSQPAA
ESSTQQRPGVPAGPRPLDGYLGVADHKPLKMHCRDCALVTSSGHLLHSRQGSQIDQTECV
IRMNDAPTRGYGRDVGNRTSLRVIAHSSIQRILRNRHDLLNVSQGTVFIFWGPSSYMRRD
GKGQVYNNLHLLSQVLPRLKAFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTI
ALELCDRINVYGMVPPDFCRDPNHPSVPYHYYEPFGPDECTMYLSHERGRKGSHHRFITE
KRVFKNWARTFNIHFFQPDWKPESLAINHPENKPVF

Sequence length

336

Interactions

View interactions

	KEGG		Reactome
	Glycosphingolipid biosynthesis - ganglio series Metabolic pathways		Sialic acid metabolism

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	17379860, 17568789

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining
Amyotrophic lateral sclerosis 1	Associate	35853630
Brain Neoplasms	Associate	26689941
Coronary Artery Disease	Associate	24399302
Coronary Disease	Associate	24399302
Glioma	Associate	17986135
Meningioma	Associate	34943806
Osteoarthritis	Associate	36799242
Uterine Cervicitis	Associate	30101434, 30360578

ST6GALNAC5 (ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 5)