SPRY4 (sprouty RTK signaling antagonist 4)

Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
81848
Gene name Gene Name - the full gene name approved by the HGNC.
Sprouty RTK signaling antagonist 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPRY4
Synonyms (NCBI Gene) Gene synonyms aliases
HH17
Disease Acronyms (UniProt) Disease acronyms from UniProt database
HH17
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q31.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a family of cysteine- and proline-rich proteins. The encoded protein is an inhibitor of the receptor-transduced mitogen-activated protein kinase (MAPK) signaling pathway. Activity of this protein impairs the formation of acti
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(4)
SNP ID Visualize variation Clinical significance Consequence
rs78310959 T>C Pathogenic, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs139512218 G>A,T Likely-benign, risk-factor, uncertain-significance Coding sequence variant, missense variant
rs142439525 C>T Conflicting-interpretations-of-pathogenicity, benign Coding sequence variant, missense variant
rs587776981 C>T Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1010)
miRTarBase ID miRNA Experiments Reference
MIRT017540 hsa-miR-335-5p Microarray 18185580
MIRT024708 hsa-miR-215-5p Microarray 19074876
MIRT026417 hsa-miR-192-5p Microarray 19074876
MIRT622110 hsa-miR-6768-5p HITS-CLIP 21572407
MIRT607178 hsa-miR-223-5p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0004860 Function Protein kinase inhibitor activity IMP 15584898
GO:0005515 Function Protein binding IPI 12027893, 15584898, 18273061, 24705354, 32296183, 32814053
GO:0005737 Component Cytoplasm IDA 15584898
GO:0005829 Component Cytosol IBA 21873635
GO:0005925 Component Focal adhesion HDA 21423176
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
607984 15533 ENSG00000187678
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9C004
Protein name Protein sprouty homolog 4 (Spry-4)
Protein function Suppresses the insulin receptor and EGFR-transduced MAPK signaling pathway, but does not inhibit MAPK activation by a constitutively active mutant Ras (PubMed:12027893). Probably impairs the formation of GTP-Ras (PubMed:12027893). Inhibits Ras-i
PDB 3BUN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05210 Sprouty 164 → 276 Sprouty protein (Spry) Family
Sequence 
MEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLAL
TTGPKRTRGGAPELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPV
ADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACGKCKCKECASPRTLPSCW
VCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCADHPCSCSRSNCCARWSFMGA
LSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDAKTSRPDKPF
Sequence length 299
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (13)
Causal
Disease term Disease name dbSNP ID References
Cryptorchidism Cryptorchidism rs121912555, rs104894697, rs104894698, rs398122886
Hearing loss Sensorineural Hearing Loss (disorder) rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359
View all (184 more)
Hypogonadotropic hypogonadism Hypogonadotropic hypogonadism, Idiopathic hypogonadotropic hypogonadism rs104894702, rs104893836, rs104893837, rs104893842, rs121909628, rs138249161, rs1601946139
Hypogonadotropic hypogonadism with or without anosmia HYPOGONADOTROPIC HYPOGONADISM 17 WITH OR WITHOUT ANOSMIA rs387906271, rs587777834, rs74315419, rs554675432, rs28939719, rs104894701, rs104894702, rs104894703, rs137852659, rs137852661, rs137852662, rs137852663, rs137852512, rs137852513, rs137852514
View all (110 more)		 23643382
Show/Hide Unknown Diseases (16)
Unknown
Disease term Disease name Evidence References Source
Mental depression Depressive disorder ClinVar
Ptosis Blepharoptosis, Ptosis ClinVar
Kallmann Syndrome Kallmann syndrome GenCC
Hypogonadotropic Hypogonadism hypogonadotropic hypogonadism GenCC
Show/Hide Text Mining Associations (67)
Associations from Text Mining
Disease Name Relationship Type References
Brain Neoplasms Inhibit 31374860
Breast Neoplasms Associate 24402575, 25742952, 28651500, 29410498, 30104400, 36274054, 36376369
Carcinogenesis Associate 25742952, 27997895, 28720069, 29214989
Carcinoma Ductal Inhibit 34048471
Carcinoma Ductal Breast Associate 34048471
Carcinoma Hepatocellular Associate 28651500, 32733618
Carcinoma Hepatocellular Stimulate 29214989
Carcinoma Intraductal Noninfiltrating Associate 34048471
Carcinoma Non Small Cell Lung Associate 15705594, 25337221, 28275056, 28651500
Carcinoma Non Small Cell Lung Inhibit 20501643