Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8174
Gene name Gene Name - the full gene name approved by the HGNC.
Mucosal vascular addressin cell adhesion molecule 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MADCAM1
Synonyms (NCBI Gene) Gene synonyms aliases
MACAM1
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is an endothelial cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1 (alpha4beta7), L-selectin, and VLA-4 (alpha4beta1) on myeloid cells to direct leukocytes into mucosal and infl
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1125103 hsa-miR-297 CLIP-seq
MIRT1125104 hsa-miR-380 CLIP-seq
MIRT1125105 hsa-miR-4495 CLIP-seq
MIRT1125106 hsa-miR-548n CLIP-seq
MIRT1125107 hsa-miR-567 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
BTF3 Repression 17312387
NFKB1 Unknown 15483224
RELA Unknown 15483224
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002687 Process Positive regulation of leukocyte migration IBA
GO:0005886 Component Plasma membrane TAS
GO:0006955 Process Immune response TAS 8502297
GO:0007155 Process Cell adhesion IEA
GO:0007155 Process Cell adhesion TAS 8502297
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
102670 6765 ENSG00000099866
Protein
UniProt ID Q13477
Protein name Mucosal addressin cell adhesion molecule 1 (MAdCAM-1) (hMAdCAM-1)
Protein function Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regula
PDB 1BQS , 1GSM , 4HBQ , 4HC1 , 4HCR , 4HD9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09085 Adhes-Ig_like 113 224 Adhesion molecule, immunoglobulin-like Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed on high endothelial venules (HEV) and lamina propia venules found in the small intestine, and to a lesser extent in the colon and spleen. Very low levels of expression found in pancreas and brain. Not expressed in the
Sequence
MDFGLALLLAGLLGLLLGQSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQW
RGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTV
SPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDED
VLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVL
HSPTSPEPPDTTSPES
PDTTSPESPDTTSQEPPDTTSPEPPDKTSPEPAPQQGSTHTPRSPGSTRTRRPEISQAGP
TQGEVIPTGSSKPAGDQLPAALWTSSAVLGLLLLALPTYHLWKRCRHLAEDDTHPPASLR
LLPQVSAWAGLRGTGQVGISPS
Sequence length 382
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell adhesion molecules
Intestinal immune network for IgA production
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Integrin cell surface interactions
<