MADCAM1 (mucosal vascular addressin cell adhesion molecule 1)

Gene

• Entrez ID: 8174
• Gene name: Mucosal vascular addressin cell adhesion molecule 1
• Gene symbol: MADCAM1
• Synonyms (NCBI Gene): MACAM1
• Chromosome: 19
• Chromosome location: 19p13.3
• Summary: The protein encoded by this gene is an endothelial cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1 (alpha4beta7), L-selectin, and VLA-4 (alpha4beta1) on myeloid cells to direct leukocytes into mucosal and infl

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1125103	hsa-miR-297	CLIP-seq
MIRT1125104	hsa-miR-380	CLIP-seq
MIRT1125105	hsa-miR-4495	CLIP-seq
MIRT1125106	hsa-miR-548n	CLIP-seq
MIRT1125107	hsa-miR-567	CLIP-seq
MIRT2265808	hsa-miR-3664-3p	CLIP-seq
MIRT2265809	hsa-miR-4433	CLIP-seq
MIRT2265810	hsa-miR-4459	CLIP-seq
MIRT2265811	hsa-miR-4768-3p	CLIP-seq
MIRT2265812	hsa-miR-515-5p	CLIP-seq
MIRT2265813	hsa-miR-583	CLIP-seq
MIRT2265808	hsa-miR-3664-3p	CLIP-seq
MIRT2265809	hsa-miR-4433	CLIP-seq
MIRT2265810	hsa-miR-4459	CLIP-seq
MIRT2265811	hsa-miR-4768-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BTF3	Repression	17312387
NFKB1	Unknown	15483224
RELA	Unknown	15483224

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002687	Process	Positive regulation of leukocyte migration	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	TAS	8502297
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	8502297
GO:0007160	Process	Cell-matrix adhesion	IDA	18308860
GO:0007165	Process	Signal transduction	TAS	8502297
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	23986478
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8502297
GO:0034113	Process	Heterotypic cell-cell adhesion	IBA
GO:0034113	Process	Heterotypic cell-cell adhesion	IMP	18308860
GO:0043113	Process	Receptor clustering	IDA	23986478
GO:0050901	Process	Leukocyte tethering or rolling	IBA
GO:0050901	Process	Leukocyte tethering or rolling	IDA	18308860
GO:0098640	Function	Integrin binding involved in cell-matrix adhesion	IBA
GO:0098640	Function	Integrin binding involved in cell-matrix adhesion	IDA	23986478
GO:0098640	Function	Integrin binding involved in cell-matrix adhesion	IEA
GO:2000403	Process	Positive regulation of lymphocyte migration	IEA

Other IDs

• MIM: 102670
• HGNC: 6765
• e!Ensembl: ENSG00000099866

Protein

• UniProt ID: Q13477
• Protein name: Mucosal addressin cell adhesion molecule 1 (MAdCAM-1) (hMAdCAM-1)
• Protein function: Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regula
• PDB: 1BQS, 1GSM, 4HBQ, 4HC1, 4HCR, 4HD9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09085	Adhes-Ig_like	113 → 224	Adhesion molecule, immunoglobulin-like	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed on high endothelial venules (HEV) and lamina propia venules found in the small intestine, and to a lesser extent in the colon and spleen. Very low levels of expression found in pancreas and brain. Not expressed in the
• Sequence:

  MDFGLALLLAGLLGLLLGQSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQW
  RGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTV
  SPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDED
  VLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVLHSPTSPEPPDTTSPES
  PDTTSPESPDTTSQEPPDTTSPEPPDKTSPEPAPQQGSTHTPRSPGSTRTRRPEISQAGP
  TQGEVIPTGSSKPAGDQLPAALWTSSAVLGLLLLALPTYHLWKRCRHLAEDDTHPPASLR
  LLPQVSAWAGLRGTGQVGISPS

• Sequence length: 382

Pathways

KEGG:

Cell adhesion molecules
Intestinal immune network for IgA production

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Integrin cell surface interactions