Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	81622
Gene name Gene Name - the full gene name approved by the HGNC.	Unc-93B1 regulator of TLR signaling
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UNC93B1
Synonyms (NCBI Gene) Gene synonyms aliases	IIAE1, UNC-93B, UNC93, UNC93B, Unc-93B1
Disease Acronyms (UniProt) Disease acronyms from UniProt database	IIAE1
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that is involved in innate and adaptive immune response by regulating toll-like receptor signaling. The encoded protein traffics nucleotide sensing toll-like receptors to the endolysosome from the endoplasmic reticulum. Deficie

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs780094017	C>A,G,T	Risk-factor	Missense variant, coding sequence variant

Show/Hide all(32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001323	hsa-miR-1-3p	pSILAC	18668040
MIRT018906	hsa-miR-335-5p	Microarray	18185580
MIRT001323	hsa-miR-1-3p	Proteomics;Other	18668040
MIRT030095	hsa-miR-26b-5p	Microarray	19088304
MIRT1475707	hsa-miR-151-5p	CLIP-seq
MIRT1475708	hsa-miR-2277-3p	CLIP-seq
MIRT1475709	hsa-miR-2277-5p	CLIP-seq
MIRT1475710	hsa-miR-615-5p	CLIP-seq
MIRT2143359	hsa-miR-106a	CLIP-seq
MIRT2143360	hsa-miR-106b	CLIP-seq
MIRT2143361	hsa-miR-17	CLIP-seq
MIRT2143362	hsa-miR-19a	CLIP-seq
MIRT2143363	hsa-miR-19b	CLIP-seq
MIRT2143364	hsa-miR-20a	CLIP-seq
MIRT2143365	hsa-miR-20b	CLIP-seq
MIRT2143366	hsa-miR-3186-3p	CLIP-seq
MIRT2143367	hsa-miR-342-3p	CLIP-seq
MIRT2143368	hsa-miR-3689d	CLIP-seq
MIRT2143369	hsa-miR-4266	CLIP-seq
MIRT2143370	hsa-miR-4292	CLIP-seq
MIRT2143371	hsa-miR-4450	CLIP-seq
MIRT2143372	hsa-miR-4667-5p	CLIP-seq
MIRT2143373	hsa-miR-4695-5p	CLIP-seq
MIRT2143374	hsa-miR-4700-5p	CLIP-seq
MIRT2143375	hsa-miR-4725-5p	CLIP-seq
MIRT2143376	hsa-miR-504	CLIP-seq
MIRT2143377	hsa-miR-518a-5p	CLIP-seq
MIRT2143378	hsa-miR-519d	CLIP-seq
MIRT2143379	hsa-miR-520g	CLIP-seq
MIRT2143380	hsa-miR-520h	CLIP-seq
MIRT2143381	hsa-miR-527	CLIP-seq
MIRT2143382	hsa-miR-93	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0002250	Process	Adaptive immune response	IEA
GO:0005515	Function	Protein binding	IPI	30833792, 32296183
GO:0005764	Component	Lysosome	IBA	21873635
GO:0005764	Component	Lysosome	ISS
GO:0005768	Component	Endosome	IBA	21873635
GO:0005768	Component	Endosome	IDA	21642595
GO:0005768	Component	Endosome	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	18082565, 21642595
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006886	Process	Intracellular protein transport	IBA	21873635
GO:0006886	Process	Intracellular protein transport	ISS
GO:0016021	Component	Integral component of membrane	IEA
GO:0032009	Component	Early phagosome	ISS
GO:0034138	Process	Toll-like receptor 3 signaling pathway	IBA	21873635
GO:0034138	Process	Toll-like receptor 3 signaling pathway	IMP	18082565
GO:0034154	Process	Toll-like receptor 7 signaling pathway	IBA	21873635
GO:0034154	Process	Toll-like receptor 7 signaling pathway	IMP	19006693
GO:0034162	Process	Toll-like receptor 9 signaling pathway	IBA	21873635
GO:0034162	Process	Toll-like receptor 9 signaling pathway	IMP	19006693
GO:0035325	Function	Toll-like receptor binding	IBA	21873635
GO:0045087	Process	Innate immune response	IEA
GO:0051607	Process	Defense response to virus	IEA

MIM	HGNC	e!Ensembl
608204	13481	ENSG00000110057

Protein

UniProt ID

Q9H1C4

Protein name

Protein unc-93 homolog B1 (Unc-93B1) (hUNC93B1)

Protein function

Plays an important role in innate and adaptive immunity by regulating nucleotide-sensing Toll-like receptor (TLR) signaling. Required for the transport of a subset of TLRs (including TLR3, TLR7 and TLR9) from the endoplasmic reticulum to endolys

PDB

7C76 , 7CYN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05978	UNC-93	115 → 194	Ion channel regulatory protein UNC-93	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in plasmocytoid dendritic cells (at protein level). Highly expressed in antigen-presenting cells. Expressed in heart, and at lower level in kidney. Expressed at low level in other tissues. {ECO:0000269|PubMed:11867227, ECO:00

Sequence

MEAEPPLYPMAGAAGPQGDEDLLGVPDGPEAPLDELVGAYPNYNEEEEERRYYRRKRLGV
LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSKMLMGINVTPI
AALLYTPVLIRFFGTKWMMFLAVGIYALFVSTNYWERYYTLVPSAVALGMAIVPLWASMG
NYITRMAQKYHEYSHYKEQDGQGMKQRPPRGSHAPYLLVFQAIFYSFFHLSFACAQLPMI
YFLNHYLYDLNHTLYNVQSCGTNSHGILSGFNKTVLRTLPRSGNLIVVESVLMAVAFLAM
LLVLGLCGAAYRPTEEIDLRSVGWGNIFQLPFKHVRDYRLRHLVPFFIYSGFEVLFACTG
IALGYGVCSVGLERLAYLLVAYSLGASAASLLGLLGLWLPRPVPLVAGAGVHLLLTFILF
FWAPVPRVLQHSWILYVAAALWGVGSALNKTGLSTLLGILYEDKERQDFIFTIYHWWQAV
AIFTVYLGSSLHMKAKLAVLLVTLVAAAVSYLRMEQKLRRGVAPRQPRIPRPQHKVRGYR
YLEEDNSDESDAEGEHGDGAEEEAPPAGPRPGPEPAGLGRRPCPYEQAQGGDGPEEQ

Sequence length

597

Interactions

View interactions

	Reactome
			Trafficking and processing of endosomal TLR UNC93B1 deficiency - HSE

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Encephalitis	herpes simplex encephalitis, susceptibility to, 1			GenCC

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining
Autoimmune Diseases	Associate	34440442
Carcinoma Ovarian Epithelial	Associate	12381271
Coronary Artery Disease	Associate	31355260
Encephalitis	Associate	37097753
Encephalitis Herpes Simplex	Associate	21722947, 22105173, 23103873, 23434283
Fractures Bone	Associate	32827035
Graves Disease	Associate	28013570
Hashimoto Disease	Associate	28013570
Heart Failure	Stimulate	31355260
Herpes Simplex	Associate	37097753
Inflammation	Associate	33627833
Macular Degeneration	Associate	29852030
Osteoporosis	Associate	32827035
Tuberculosis Meningeal	Associate	32827035

UNC93B1 (unc-93B1 regulator of TLR signaling)