Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
81620
Gene name Gene Name - the full gene name approved by the HGNC.
Chromatin licensing and DNA replication factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CDT1
Synonyms (NCBI Gene) Gene synonyms aliases
DUP, RIS2
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is involved in the formation of the pre-replication complex that is necessary for DNA replication. The encoded protein can bind geminin, which prevents replication and may function to prevent this protein from initiating r
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs3218727 C>T Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs144843732 A>T Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs147914553 C>A,G,T Pathogenic Coding sequence variant, stop gained, synonymous variant
rs200652608 G>A,C Pathogenic Missense variant, coding sequence variant
rs387906917 G>A Likely-pathogenic, pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016534 hsa-miR-193b-3p Microarray 20304954
MIRT050529 hsa-miR-20a-5p CLASH 23622248
MIRT045201 hsa-miR-186-5p CLASH 23622248
MIRT635630 hsa-miR-1228-3p HITS-CLIP 19536157
MIRT718835 hsa-miR-660-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000076 Process DNA replication checkpoint IBA 21873635
GO:0000076 Process DNA replication checkpoint IDA 14672932
GO:0000082 Process G1/S transition of mitotic cell cycle TAS
GO:0000083 Process Regulation of transcription involved in G1/S transition of mitotic cell cycle TAS
GO:0000278 Process Mitotic cell cycle IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605525 24576 ENSG00000167513
Protein
UniProt ID Q9H211
Protein name DNA replication factor Cdt1 (Double parked homolog) (DUP)
Protein function Required for both DNA replication and mitosis (PubMed:11125146, PubMed:14993212, PubMed:21856198, PubMed:22581055, PubMed:26842564). DNA replication licensing factor, required for pre-replication complex assembly. Cooperates with CDC6 and the or
PDB 2LE8 , 2WVR , 6QCG , 8RWV , 8S0E , 8S0F
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08839 CDT1 186 349 DNA replication factor CDT1 like Domain
PF16679 CDT1_C 421 516 DNA replication factor Cdt1 C-terminal domain Domain
Sequence
MEQRRVTDFFARRRPGPPRIAPPKLACRTPSPARPALRAPASATSGSRKRARPPAAPGRD
QARPPARRRLRLSVDEVSSPSTPEAPDIPACPSPGQKIKKSTPAAGQPPHLTSAQDQDTI
SELASCLQRARELGARVRALKASAQDAGESCTPEAEGRPEEPCGEKAPAYQRFHALAQPG
LPGLVLPYKYQVLAEMFRSMDTIVGMLHNRSETPTFAKVQRGVQDMMRRRFEECNVGQIK
TVYPASYRFRQERSVPTFKDGTRRSDYQLTIEPLLEQEADGAAPQLTASRLLQRRQIFSQ
KLVEHVKEHHKAFLASLSPAMVVPEDQLTRWHPRFNVDEVPDIEPAALP
QPPATEKLTTA
QEVLARARNLISPRMEKALSQLALRSAAPSSPGSPRPALPATPPATPPAASPSALKGVSQ
DLLERIRAKEAQKQLAQMTRCPEQEQRLQRLERLPELARVLRSVFVSERKPALSMEVACA
RMVGSCCTIMSPGEMEKHLLLLSELLPDWLSLHRIR
TDTYVKLDKAADLAHITARLAHQT
RAEEGL
Sequence length 546
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell cycle   CDT1 association with the CDC6:ORC:origin complex
Assembly of the pre-replicative complex
Orc1 removal from chromatin
Activation of the pre-replicative complex
G1/S-Specific Transcription
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Craniosynostosis Craniosynostosis rs104893895, rs587777006, rs587777007, rs587777008, rs587777010, rs864321680, rs864321681, rs1057517670, rs1064794325, rs1555750816, rs1599823350
Cryptorchidism Cryptorchidism rs121912555, rs104894697, rs104894698, rs398122886
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Meier-gorlin syndrome MEIER-GORLIN SYNDROME 4 rs121918494, rs387906826, rs143141689, rs387906828, rs1557573504, rs1378348220, rs387906842, rs387906847, rs797044461, rs387906917, rs147914553, rs779871947, rs387906918, rs200652608, rs786205258
View all (16 more)
21358632, 15286659, 21358631
Unknown
Disease term Disease name Evidence References Source
Specific learning disorder Specific learning disability ClinVar
Gorlin Syndrome Meier-Gorlin syndrome GenCC
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37790630
Aneuploidy Associate 22479651
Carcinogenesis Associate 22479651
Carcinoma Hepatocellular Associate 36443564, 40255404
Carcinoma Pancreatic Ductal Associate 38423594
Carcinoma Renal Cell Associate 34872567
Cardiomyopathies Associate 32196466
Cardiovascular Diseases Associate 21418584
Colorectal Neoplasms Inhibit 25634203
Ear Diseases Associate 23516378