FIP1L1 (factor interacting with PAPOLA and CPSF1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
81608
Gene name Gene Name - the full gene name approved by the HGNC.
Factor interacting with PAPOLA and CPSF1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FIP1L1
Synonyms (NCBI Gene) Gene synonyms aliases
FIP1, Rhe, hFip1
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a subunit of the CPSF (cleavage and polyadenylation specificity factor) complex that polyadenylates the 3` end of mRNA precursors. This gene, the homolog of yeast Fip1 (factor interacting with PAP), binds to U-rich sequences of pre-mRNA
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(32)
miRTarBase ID miRNA Experiments Reference
MIRT020609 hsa-miR-155-5p Proteomics 18668040
MIRT036936 hsa-miR-877-3p CLASH 23622248
MIRT996944 hsa-miR-3682-5p CLIP-seq
MIRT996945 hsa-miR-4490 CLIP-seq
MIRT996946 hsa-miR-4731-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome TAS
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IBA 21873635
GO:0005515 Function Protein binding IPI 15937220, 19224921, 25416956, 29276085
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
607686 19124 ENSG00000145216
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q6UN15
Protein name Pre-mRNA 3'-end-processing factor FIP1 (hFip1) (FIP1-like 1 protein) (Factor interacting with PAP) (Rearranged in hypereosinophilia)
Protein function Component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about c
PDB 7K95 , 7ZY4 , 7ZYH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05182 Fip1 154 → 196 Fip1 motif Motif
Sequence 
MSAGEVERLVSELSGGTGGDEEEEWLYGGPWDVHVHSDLAKDLDENEVERPEEENASANP
PSGIEDETAENGVPKPKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNL
NIKTGGRVYGTTGTKVKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGF
NEDTWKAYCEKQKRIRMGLEVIPVTSTTNKITAEDCTMEVTPGAEIQDGRFNLFKVQQGR
TGNSEKETALPSTKAEFTSPPSLFKTGLPPSRNSTSSQSQTSTASRKANSSVGKWQDRYG
RAESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFSKPPPFF
PPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPPSLIPTIESGHSSGYDSRS
ARAFPYGNVAFPHLPGSAPSWPSLVDTSKQWDYYARREKDRDRERDRDRERDRDRDRERE
RTRERERERDHSPTPSVFNSDEERYRYREYAERGYERHRASREKEERHRERRHREKEETR
HKSSRSNSRRRHESEEGDSHRRHKHKKSKRSKEGKEAGSEPAPEQESTEATPAE
Sequence length 594
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  mRNA surveillance pathway   Transport of Mature mRNA Derived from an Intronless Transcript
mRNA Splicing - Major Pathway
mRNA 3'-end processing
RNA Polymerase II Transcription Termination
Processing of Intronless Pre-mRNAs
Signaling by cytosolic PDGFRA and PDGFRB fusion proteins
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (4)
Causal
Disease term Disease name dbSNP ID References
Anemia Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
Hypofibrinogenemia Hypofibrinogenemia rs121913087, rs121913088, rs587776837, rs121909616, rs121909625, rs121909608, rs121909607, rs146387238, rs1578795296, rs1214070111, rs776817952, rs762964798, rs121909606, rs1414035000, rs1310452604
Neutropenia Neutropenia rs879253882
Pancytopenia Pancytopenia rs869312883, rs770551610, rs1131690788, rs530073586, rs374333820
Show/Hide Unknown Diseases (4)
Unknown
Disease term Disease name Evidence References Source
Congestive heart failure Congestive heart failure 28347583 ClinVar
Heart failure Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided 28347583 ClinVar
Hypereosinophilic syndrome Idiopathic Hypereosinophilic Syndrome, Hypereosinophilic syndrome, Primary hypereosinophilic syndrome 16778211, 28347583 ClinVar
Myocardial infarction Myocardial Failure 28347583 ClinVar
Show/Hide Text Mining Associations (32)
Associations from Text Mining
Disease Name Relationship Type References
Asthma Associate 34045202
Bone Marrow Diseases Associate 24669761
Cancer Pain Associate 26182612
Cough Associate 16387954
Eosinophilia Associate 15284118, 16387954, 20955401, 21819482, 22271894, 22523564, 26017288, 29025601, 32720700
Esophageal Squamous Cell Carcinoma Associate 33403789
Glioblastoma Associate 34047477
Glioma Associate 29272522, 34047477
Growth Disorders Associate 20010473
Hypereosinophilic Syndrome Associate 12660384, 14504092, 14630792, 15284118, 16387954, 16409293, 17591942, 17666373, 18307562, 19671059, 19910029, 20810155, 21819482, 22279048, 23914042
View all (4 more)