FIP1L1 (factor interacting with PAPOLA and CPSF1)

Gene

• Entrez ID: 81608
• Gene name: Factor interacting with PAPOLA and CPSF1
• Gene symbol: FIP1L1
• Synonyms (NCBI Gene): FIP1, Rhe, hFip1
• Chromosome: 4
• Chromosome location: 4q12
• Summary: This gene encodes a subunit of the CPSF (cleavage and polyadenylation specificity factor) complex that polyadenylates the 3` end of mRNA precursors. This gene, the homolog of yeast Fip1 (factor interacting with PAP), binds to U-rich sequences of pre-mRNA

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020609	hsa-miR-155-5p	Proteomics	18668040
MIRT036936	hsa-miR-877-3p	CLASH	23622248
MIRT996944	hsa-miR-3682-5p	CLIP-seq
MIRT996945	hsa-miR-4490	CLIP-seq
MIRT996946	hsa-miR-4731-3p	CLIP-seq
MIRT996947	hsa-miR-4774-5p	CLIP-seq
MIRT996948	hsa-miR-4789-5p	CLIP-seq
MIRT996949	hsa-miR-4801	CLIP-seq
MIRT2533548	hsa-miR-1261	CLIP-seq
MIRT2533549	hsa-miR-142-5p	CLIP-seq
MIRT2533550	hsa-miR-23a	CLIP-seq
MIRT2533551	hsa-miR-23b	CLIP-seq
MIRT2533552	hsa-miR-23c	CLIP-seq
MIRT2533553	hsa-miR-3201	CLIP-seq
MIRT2533554	hsa-miR-340	CLIP-seq
MIRT2533555	hsa-miR-4317	CLIP-seq
MIRT2533556	hsa-miR-432	CLIP-seq
MIRT2533557	hsa-miR-4791	CLIP-seq
MIRT2533558	hsa-miR-511	CLIP-seq
MIRT2533559	hsa-miR-578	CLIP-seq
MIRT2533560	hsa-miR-616	CLIP-seq
MIRT2533561	hsa-miR-626	CLIP-seq
MIRT2533548	hsa-miR-1261	CLIP-seq
MIRT2533549	hsa-miR-142-5p	CLIP-seq
MIRT2533550	hsa-miR-23a	CLIP-seq
MIRT2533551	hsa-miR-23b	CLIP-seq
MIRT2533552	hsa-miR-23c	CLIP-seq
MIRT2533553	hsa-miR-3201	CLIP-seq
MIRT2533554	hsa-miR-340	CLIP-seq
MIRT2533556	hsa-miR-432	CLIP-seq
MIRT2533557	hsa-miR-4791	CLIP-seq
MIRT2533559	hsa-miR-578	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	15937220, 16189514, 19224921, 25416956, 26496610, 29276085, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005847	Component	MRNA cleavage and polyadenylation specificity factor complex	IBA
GO:0006397	Process	MRNA processing	IEA

Other IDs

• MIM: 607686
• HGNC: 19124
• e!Ensembl: ENSG00000145216

Protein

• UniProt ID: Q6UN15
• Protein name: Pre-mRNA 3'-end-processing factor FIP1 (hFip1) (FIP1-like 1 protein) (Factor interacting with PAP) (Rearranged in hypereosinophilia)
• Protein function: Component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about c
• PDB: 7K95, 7ZY4, 7ZYH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05182	Fip1	154 → 196	Fip1 motif	Motif

• Sequence:

  MSAGEVERLVSELSGGTGGDEEEEWLYGGPWDVHVHSDLAKDLDENEVERPEEENASANP
  PSGIEDETAENGVPKPKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNL
  NIKTGGRVYGTTGTKVKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGF
  NEDTWKAYCEKQKRIRMGLEVIPVTSTTNKITAEDCTMEVTPGAEIQDGRFNLFKVQQGR
  TGNSEKETALPSTKAEFTSPPSLFKTGLPPSRNSTSSQSQTSTASRKANSSVGKWQDRYG
  RAESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFSKPPPFF
  PPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPPSLIPTIESGHSSGYDSRS
  ARAFPYGNVAFPHLPGSAPSWPSLVDTSKQWDYYARREKDRDRERDRDRERDRDRDRERE
  RTRERERERDHSPTPSVFNSDEERYRYREYAERGYERHRASREKEERHRERRHREKEETR
  HKSSRSNSRRRHESEEGDSHRRHKHKKSKRSKEGKEAGSEPAPEQESTEATPAE

• Sequence length: 594

Pathways

KEGG:

mRNA surveillance pathway

Reactome:

Transport of Mature mRNA Derived from an Intronless Transcript
mRNA Splicing - Major Pathway
mRNA 3'-end processing
RNA Polymerase II Transcription Termination
Processing of Intronless Pre-mRNAs
Signaling by cytosolic PDGFRA and PDGFRB fusion proteins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC EOSINOPHILIC LEUKEMIA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEREOSINOPHILIC SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY HYPEREOSINOPHILIC SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Asthma	Associate	34045202	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Associate	24669761	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Associate	26182612	★☆☆☆☆ Found in Text Mining only
Cough	Associate	16387954	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Associate	15284118, 16387954, 20955401, 21819482, 22271894, 22523564, 26017288, 29025601, 32720700	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Associate	33403789	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	34047477	★☆☆☆☆ Found in Text Mining only
Glioma	Associate	29272522, 34047477	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Associate	20010473	★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Associate	12660384, 14504092, 14630792, 15284118, 16387954, 16409293, 17591942, 17666373, 18307562, 19671059, 19910029, 20810155, 21819482, 22279048, 23914042, 25398061, 26182612, 28885361, 29538200	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Associate	18619723, 22271894	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoma Adult T Cell	Associate	29025601	★☆☆☆☆ Found in Text Mining only
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	20010473, 22271894	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	14630792, 24669761, 29025601, 34482400, 36517458	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Associate	24669761	★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	28885361	★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell	Associate	28885361	★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Associate	12842979, 15284118	★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Associate	17299092, 17440089, 36517458	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	22271894	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	23637631, 26797802, 28885361, 29025601, 32720700, 34045202	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	33403789	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	30157244	★☆☆☆☆ Found in Text Mining only
Pdgfra Associated Chronic Eosinophilic Leukemia	Associate	14630792, 16645167, 17299092, 17440089, 17555450, 17591942, 18307562, 18619723, 18950453, 19013640, 20558942, 22523564, 24407160, 25398061, 27120808, 27960034, 28885361	★☆☆☆☆ Found in Text Mining only
Pdgfrb Associated Chronic Eosinophilic Leukemia	Associate	30359545	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	29025601, 36517458	★☆☆☆☆ Found in Text Mining only
Red Cell Aplasia Pure	Associate	20558942	★☆☆☆☆ Found in Text Mining only
Rhinitis	Associate	34045202	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Associate	34045202	★☆☆☆☆ Found in Text Mining only
Synovitis	Associate	23914042	★☆☆☆☆ Found in Text Mining only
Thrombosis	Associate	23914042	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Associate	35354918	★☆☆☆☆ Found in Text Mining only