FIP1L1 (factor interacting with PAPOLA and CPSF1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 81608
Gene name Factor interacting with PAPOLA and CPSF1
Gene symbol FIP1L1
Synonyms (NCBI Gene)
FIP1RhehFip1
Chromosome 4
Chromosome location 4q12
Summary This gene encodes a subunit of the CPSF (cleavage and polyadenylation specificity factor) complex that polyadenylates the 3` end of mRNA precursors. This gene, the homolog of yeast Fip1 (factor interacting with PAP), binds to U-rich sequences of pre-mRNA
miRNA miRNA information provided by mirtarbase database.
32
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (32)
miRTarBase ID miRNA Experiments Reference
MIRT020609 hsa-miR-155-5p Proteomics 18668040
MIRT036936 hsa-miR-877-3p CLASH 23622248
MIRT996944 hsa-miR-3682-5p CLIP-seq
MIRT996945 hsa-miR-4490 CLIP-seq
MIRT996946 hsa-miR-4731-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (9)
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IEA
GO:0005515 Function Protein binding IPI 15937220, 16189514, 19224921, 25416956, 26496610, 29276085, 33961781
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
607686 19124 ENSG00000145216
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UN15
Protein name Pre-mRNA 3'-end-processing factor FIP1 (hFip1) (FIP1-like 1 protein) (Factor interacting with PAP) (Rearranged in hypereosinophilia)
Protein function Component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about c
PDB 7K95 , 7ZY4 , 7ZYH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05182 Fip1 154 → 196 Fip1 motif Motif
Sequence 
MSAGEVERLVSELSGGTGGDEEEEWLYGGPWDVHVHSDLAKDLDENEVERPEEENASANP
PSGIEDETAENGVPKPKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNL
NIKTGGRVYGTTGTKVKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGF
NEDTWKAYCEKQKRIRMGLEVIPVTSTTNKITAEDCTMEVTPGAEIQDGRFNLFKVQQGR
TGNSEKETALPSTKAEFTSPPSLFKTGLPPSRNSTSSQSQTSTASRKANSSVGKWQDRYG
RAESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFSKPPPFF
PPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGFPPPPGAPPPSLIPTIESGHSSGYDSRS
ARAFPYGNVAFPHLPGSAPSWPSLVDTSKQWDYYARREKDRDRERDRDRERDRDRDRERE
RTRERERERDHSPTPSVFNSDEERYRYREYAERGYERHRASREKEERHRERRHREKEETR
HKSSRSNSRRRHESEEGDSHRRHKHKKSKRSKEGKEAGSEPAPEQESTEATPAE
Sequence length 594
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  mRNA surveillance pathway   Transport of Mature mRNA Derived from an Intronless Transcript
mRNA Splicing - Major Pathway
mRNA 3'-end processing
RNA Polymerase II Transcription Termination
Processing of Intronless Pre-mRNAs
Signaling by cytosolic PDGFRA and PDGFRB fusion proteins
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
EBV-positive nodal T- and NK-cell lymphoma Likely benign rs1187223632, rs2476236691 RCV004560276
RCV004560277
Show/Hide Text Mining Associations (32)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Asthma Associate 34045202
Bone Marrow Diseases Associate 24669761
Cancer Pain Associate 26182612
Cough Associate 16387954
Eosinophilia Associate 15284118, 16387954, 20955401, 21819482, 22271894, 22523564, 26017288, 29025601, 32720700
Esophageal Squamous Cell Carcinoma Associate 33403789
Glioblastoma Associate 34047477
Glioma Associate 29272522, 34047477
Growth Disorders Associate 20010473
Hypereosinophilic Syndrome Associate 12660384, 14504092, 14630792, 15284118, 16387954, 16409293, 17591942, 17666373, 18307562, 19671059, 19910029, 20810155, 21819482, 22279048, 23914042
View all (4 more)