Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
81603
Gene name Gene Name - the full gene name approved by the HGNC.
Tripartite motif containing 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRIM8
Synonyms (NCBI Gene) Gene synonyms aliases
FSGSNEDS, GERP, RNF27
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q24.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the tripartite motif (TRIM) protein family. Based on similarities to other proteins, the encoded protein is suspected to be an E3 ubiquitin-protein ligase. Regulation of this gene may be altered in some cancers. Mutations res
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018878 hsa-miR-335-5p Microarray 18185580
MIRT025917 hsa-miR-7-5p Microarray 19073608
MIRT051030 hsa-miR-17-5p CLASH 23622248
MIRT048914 hsa-miR-93-5p CLASH 23622248
MIRT261132 hsa-miR-656-3p PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0003713 Function Transcription coactivator activity IDA 23077300
GO:0005515 Function Protein binding IPI 19549727, 32296183, 32814053
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus IMP 33508234
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606125 15579 ENSG00000171206
Protein
UniProt ID Q9BZR9
Protein name E3 ubiquitin-protein ligase TRIM8 (EC 2.3.2.27) (Glioblastoma-expressed RING finger protein) (RING finger protein 27) (RING-type E3 ubiquitin transferase TRIM8) (Tripartite motif-containing protein 8)
Protein function E3 ubiquitin-protein ligase that participates in multiple biological processes including cell survival, differentiation, apoptosis, and in particular, the innate immune response (PubMed:27981609, PubMed:28747347). Participates in the activation
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15227 zf-C3HC4_4 15 55 Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in glomerular podocytes of kidneys. {ECO:0000269|PubMed:33508234, ECO:0000305}.
Sequence
MAENWKNCFEEELICPICLHVFVEPVQLPCKHNFCRGCIGEAWAKDSGLVRCPECNQAYN
QKPGLEKNLKLTNIVEKFNALHVEKPPAALHCVFCRRGPPLPAQKVCLRCEAPCCQSHVQ
THLQQPSTARGHLLVEADDVRAWSCPQHNAYRLYHCEAEQVAVCQYCCYYSGAHQGHSVC
DVEIRRNEIRKMLMKQQDRLEEREQDIEDQLYKLESDKRLVEEKVNQLKEEVRLQYEKLH
QLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGSLQLLFDKTEDVSFMK
NTKSVKILMDRTQTCTSSSLSPTKIGHLNSKLFLNEVAKKEKQLRKMLEGPFSTPVPFLQ
SVPLYPCGVSSSGAEKRKHSTAFPEASFLETSSGPVGGQYGAAGTASGEGQSGQPLGPCS
STQHLVALPGGAQPVHSSPVFPPSQYPNGSAAQQPMLPQYGGRKILVCSVDNCYCSSVAN
HGGHQPYPRSGHFPWTVPSQEYSHPLPPTPSVPQSLPSLAVRDWLDASQQPGHQDFYRVY
GQPSTKHYVTS
Sequence length 551
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Interferon gamma signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Focal segmental glomerulosclerosis Focal segmental glomerulosclerosis and neurodevelopmental syndrome rs866294686 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Developmental And Epileptic Encephalopathy genetic developmental and epileptic encephalopathy N/A N/A GenCC
Mental Depression Major depressive disorder N/A N/A GWAS
Prostate cancer Prostate cancer N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 34916780
Asthma Associate 35470728
Bicuspid Aortic Valve Disease Associate 36071494
Brain Diseases Associate 34930159
Carcinogenesis Associate 26077989
Carcinoma Renal Cell Inhibit 25277184
Carcinoma Renal Cell Associate 33173411
Cholangiocarcinoma Associate 36635225
Drug Hypersensitivity Associate 32603359
Eyelid Diseases Associate 38088023