Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	81603
Gene name Gene Name - the full gene name approved by the HGNC.	Tripartite motif containing 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TRIM8
Synonyms (NCBI Gene) Gene synonyms aliases	FSGSNEDS, GERP, RNF27
Disease Acronyms (UniProt) Disease acronyms from UniProt database	FSGSNEDS
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q24.32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the tripartite motif (TRIM) protein family. Based on similarities to other proteins, the encoded protein is suspected to be an E3 ubiquitin-protein ligase. Regulation of this gene may be altered in some cancers. Mutations res

Show/Hide all(157)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018878	hsa-miR-335-5p	Microarray	18185580
MIRT025917	hsa-miR-7-5p	Microarray	19073608
MIRT051030	hsa-miR-17-5p	CLASH	23622248
MIRT048914	hsa-miR-93-5p	CLASH	23622248
MIRT261132	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT261131	hsa-miR-126-5p	PAR-CLIP	21572407
MIRT553360	hsa-miR-130b-5p	PAR-CLIP	21572407
MIRT553359	hsa-miR-3140-3p	PAR-CLIP	21572407
MIRT261133	hsa-miR-889-3p	PAR-CLIP	21572407
MIRT261134	hsa-miR-4477a	PAR-CLIP	21572407
MIRT261135	hsa-miR-4795-3p	PAR-CLIP	21572407
MIRT553358	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT553357	hsa-miR-4768-5p	PAR-CLIP	21572407
MIRT553356	hsa-miR-6833-3p	PAR-CLIP	21572407
MIRT553355	hsa-miR-6809-3p	PAR-CLIP	21572407
MIRT553354	hsa-miR-6885-3p	PAR-CLIP	21572407
MIRT125727	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT125725	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT125727	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT051030	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT125734	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT048914	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT125745	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT125725	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT051030	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR, Western blot	28327152
MIRT051030	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR, Western blot	28327152
MIRT125727	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	28327152
MIRT125727	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	28327152
MIRT051030	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR	26077989
MIRT261132	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT261131	hsa-miR-126-5p	PAR-CLIP	21572407
MIRT553360	hsa-miR-130b-5p	PAR-CLIP	21572407
MIRT553359	hsa-miR-3140-3p	PAR-CLIP	21572407
MIRT261133	hsa-miR-889-3p	PAR-CLIP	21572407
MIRT261134	hsa-miR-4477a	PAR-CLIP	21572407
MIRT261135	hsa-miR-4795-3p	PAR-CLIP	21572407
MIRT553358	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT553357	hsa-miR-4768-5p	PAR-CLIP	21572407
MIRT553356	hsa-miR-6833-3p	PAR-CLIP	21572407
MIRT553355	hsa-miR-6809-3p	PAR-CLIP	21572407
MIRT553354	hsa-miR-6885-3p	PAR-CLIP	21572407
MIRT1456115	hsa-miR-1	CLIP-seq
MIRT1456116	hsa-miR-1245	CLIP-seq
MIRT1456117	hsa-miR-1252	CLIP-seq
MIRT1456118	hsa-miR-1253	CLIP-seq
MIRT1456119	hsa-miR-1273e	CLIP-seq
MIRT1456120	hsa-miR-1288	CLIP-seq
MIRT1456121	hsa-miR-1290	CLIP-seq
MIRT1456122	hsa-miR-206	CLIP-seq
MIRT1456123	hsa-miR-3150b-3p	CLIP-seq
MIRT1456124	hsa-miR-3154	CLIP-seq
MIRT1456125	hsa-miR-3167	CLIP-seq
MIRT1456126	hsa-miR-3192	CLIP-seq
MIRT1456127	hsa-miR-3199	CLIP-seq
MIRT1456128	hsa-miR-3545-3p	CLIP-seq
MIRT1456129	hsa-miR-3650	CLIP-seq
MIRT1456130	hsa-miR-3661	CLIP-seq
MIRT1456131	hsa-miR-3673	CLIP-seq
MIRT1456132	hsa-miR-3677-5p	CLIP-seq
MIRT1456133	hsa-miR-3915	CLIP-seq
MIRT1456134	hsa-miR-3927	CLIP-seq
MIRT1456135	hsa-miR-3928	CLIP-seq
MIRT1456136	hsa-miR-3974	CLIP-seq
MIRT1456137	hsa-miR-4276	CLIP-seq
MIRT1456138	hsa-miR-4305	CLIP-seq
MIRT1456139	hsa-miR-4314	CLIP-seq
MIRT1456140	hsa-miR-4426	CLIP-seq
MIRT1456141	hsa-miR-4434	CLIP-seq
MIRT1456142	hsa-miR-4476	CLIP-seq
MIRT1456143	hsa-miR-4516	CLIP-seq
MIRT1456144	hsa-miR-4646-5p	CLIP-seq
MIRT1456145	hsa-miR-4647	CLIP-seq
MIRT1456146	hsa-miR-4648	CLIP-seq
MIRT1456147	hsa-miR-4662b	CLIP-seq
MIRT1456148	hsa-miR-4680-5p	CLIP-seq
MIRT1456149	hsa-miR-4689	CLIP-seq
MIRT1456150	hsa-miR-4710	CLIP-seq
MIRT1456151	hsa-miR-4722-5p	CLIP-seq
MIRT1456152	hsa-miR-4747-5p	CLIP-seq
MIRT1456153	hsa-miR-4768-3p	CLIP-seq
MIRT1456154	hsa-miR-4784	CLIP-seq
MIRT1456155	hsa-miR-4792	CLIP-seq
MIRT1456156	hsa-miR-4795-5p	CLIP-seq
MIRT1456157	hsa-miR-486-3p	CLIP-seq
MIRT1456158	hsa-miR-539	CLIP-seq
MIRT1456159	hsa-miR-548m	CLIP-seq
MIRT1456160	hsa-miR-550b	CLIP-seq
MIRT1456161	hsa-miR-570	CLIP-seq
MIRT1456162	hsa-miR-580	CLIP-seq
MIRT1456163	hsa-miR-613	CLIP-seq
MIRT1456164	hsa-miR-631	CLIP-seq
MIRT1456165	hsa-miR-876-5p	CLIP-seq
MIRT2136710	hsa-miR-2355-5p	CLIP-seq
MIRT2136711	hsa-miR-3065-5p	CLIP-seq
MIRT2136712	hsa-miR-3125	CLIP-seq
MIRT2136713	hsa-miR-3148	CLIP-seq
MIRT1456123	hsa-miR-3150b-3p	CLIP-seq
MIRT2136714	hsa-miR-3179	CLIP-seq
MIRT2136715	hsa-miR-3193	CLIP-seq
MIRT2136716	hsa-miR-3611	CLIP-seq
MIRT2136717	hsa-miR-3667-3p	CLIP-seq
MIRT2136718	hsa-miR-370	CLIP-seq
MIRT2136719	hsa-miR-3916	CLIP-seq
MIRT2136720	hsa-miR-4271	CLIP-seq
MIRT2136721	hsa-miR-4446-3p	CLIP-seq
MIRT2136722	hsa-miR-4455	CLIP-seq
MIRT2136723	hsa-miR-4533	CLIP-seq
MIRT2136724	hsa-miR-4645-5p	CLIP-seq
MIRT2136725	hsa-miR-4667-3p	CLIP-seq
MIRT2136726	hsa-miR-4668-3p	CLIP-seq
MIRT2136727	hsa-miR-4673	CLIP-seq
MIRT2136728	hsa-miR-4675	CLIP-seq
MIRT2136729	hsa-miR-4691-3p	CLIP-seq
MIRT2136730	hsa-miR-4698	CLIP-seq
MIRT2136731	hsa-miR-4725-3p	CLIP-seq
MIRT2136732	hsa-miR-4738-5p	CLIP-seq
MIRT2136733	hsa-miR-4741	CLIP-seq
MIRT2136734	hsa-miR-4742-5p	CLIP-seq
MIRT1456152	hsa-miR-4747-5p	CLIP-seq
MIRT2136735	hsa-miR-4749-3p	CLIP-seq
MIRT1456153	hsa-miR-4768-3p	CLIP-seq
MIRT1456154	hsa-miR-4784	CLIP-seq
MIRT2136736	hsa-miR-4787-5p	CLIP-seq
MIRT2136737	hsa-miR-592	CLIP-seq
MIRT2136738	hsa-miR-597	CLIP-seq
MIRT2136739	hsa-miR-628-5p	CLIP-seq
MIRT2136740	hsa-miR-671-5p	CLIP-seq
MIRT2136741	hsa-miR-711	CLIP-seq
MIRT2136742	hsa-miR-877	CLIP-seq
MIRT2357522	hsa-miR-4520a-5p	CLIP-seq
MIRT2357523	hsa-miR-4520b-5p	CLIP-seq
MIRT2357524	hsa-miR-4532	CLIP-seq
MIRT2136724	hsa-miR-4645-5p	CLIP-seq
MIRT2136726	hsa-miR-4668-3p	CLIP-seq
MIRT2136727	hsa-miR-4673	CLIP-seq
MIRT2136730	hsa-miR-4698	CLIP-seq
MIRT2136734	hsa-miR-4742-5p	CLIP-seq
MIRT2136737	hsa-miR-592	CLIP-seq
MIRT2136738	hsa-miR-597	CLIP-seq
MIRT2136741	hsa-miR-711	CLIP-seq
MIRT2462372	hsa-miR-1178	CLIP-seq
MIRT2462373	hsa-miR-4700-3p	CLIP-seq
MIRT2136737	hsa-miR-592	CLIP-seq
MIRT2136738	hsa-miR-597	CLIP-seq
MIRT2462372	hsa-miR-1178	CLIP-seq
MIRT2462373	hsa-miR-4700-3p	CLIP-seq
MIRT2136737	hsa-miR-592	CLIP-seq
MIRT2136738	hsa-miR-597	CLIP-seq
MIRT2651246	hsa-miR-146a	CLIP-seq
MIRT2651247	hsa-miR-146b-5p	CLIP-seq
MIRT2651248	hsa-miR-1539	CLIP-seq
MIRT2357522	hsa-miR-4520a-5p	CLIP-seq
MIRT2357523	hsa-miR-4520b-5p	CLIP-seq
MIRT1456153	hsa-miR-4768-3p	CLIP-seq
MIRT1456162	hsa-miR-580	CLIP-seq
MIRT2651249	hsa-miR-589	CLIP-seq
MIRT2651250	hsa-miR-665	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003713	Function	Transcription coactivator activity	IDA	23077300
GO:0005515	Function	Protein binding	IPI	19549727, 32296183, 32814053
GO:0005829	Component	Cytosol	TAS
GO:0008270	Function	Zinc ion binding	NAS	11118312
GO:0010508	Process	Positive regulation of autophagy	IMP	26347139
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016605	Component	PML body	IDA	11331580
GO:0016740	Function	Transferase activity	IEA
GO:0019827	Process	Stem cell population maintenance	IEA
GO:0032897	Process	Negative regulation of viral transcription	IEA
GO:0042802	Function	Identical protein binding	IPI	22493164, 22829933
GO:0042803	Function	Protein homodimerization activity	IPI	11331580
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	23077300
GO:0045087	Process	Innate immune response	IDA	18248090
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA
GO:0046597	Process	Negative regulation of viral entry into host cell	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	23077300
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	23077300
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:1900182	Process	Positive regulation of protein localization to nucleus	IEA
GO:1902187	Process	Negative regulation of viral release from host cell	IDA	18248090

MIM	HGNC	e!Ensembl
606125	15579	ENSG00000171206

Protein

UniProt ID

Q9BZR9

Protein name

E3 ubiquitin-protein ligase TRIM8 (EC 2.3.2.27) (Glioblastoma-expressed RING finger protein) (RING finger protein 27) (RING-type E3 ubiquitin transferase TRIM8) (Tripartite motif-containing protein 8)

Protein function

E3 ubiquitin-protein ligase that participates in multiple biological processes including cell survival, differentiation, apoptosis, and in particular, the innate immune response (PubMed:27981609, PubMed:28747347). Participates in the activation

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15227	zf-C3HC4_4	15 → 55		Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed in glomerular podocytes of kidneys. {ECO:0000269|PubMed:33508234, ECO:0000305}.

Sequence

MAENWKNCFEEELICPICLHVFVEPVQLPCKHNFCRGCIGEAWAKDSGLVRCPECNQAYN
QKPGLEKNLKLTNIVEKFNALHVEKPPAALHCVFCRRGPPLPAQKVCLRCEAPCCQSHVQ
THLQQPSTARGHLLVEADDVRAWSCPQHNAYRLYHCEAEQVAVCQYCCYYSGAHQGHSVC
DVEIRRNEIRKMLMKQQDRLEEREQDIEDQLYKLESDKRLVEEKVNQLKEEVRLQYEKLH
QLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGSLQLLFDKTEDVSFMK
NTKSVKILMDRTQTCTSSSLSPTKIGHLNSKLFLNEVAKKEKQLRKMLEGPFSTPVPFLQ
SVPLYPCGVSSSGAEKRKHSTAFPEASFLETSSGPVGGQYGAAGTASGEGQSGQPLGPCS
STQHLVALPGGAQPVHSSPVFPPSQYPNGSAAQQPMLPQYGGRKILVCSVDNCYCSSVAN
HGGHQPYPRSGHFPWTVPSQEYSHPLPPTPSVPQSLPSLAVRDWLDASQQPGHQDFYRVY
GQPSTKHYVTS

Sequence length

551

Interactions

View interactions

	Reactome
			Interferon gamma signaling

Show/Hide Causal Diseases (17)

Disease term	Disease name	dbSNP ID	References
Causal
Autism	Autistic behavior	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)	23934111
Developmental regression	Developmental regression	rs1224421127
Epileptic encephalopathy	Early infantile epileptic encephalopathy with suppression bursts, Early infantile epileptic encephalopathy	rs587776508, rs121918334, rs121918317, rs121918321, rs74315390, rs28939684, rs74315391, rs74315392, rs118192244, rs121918622, rs121918623, rs121917953, rs121917955, rs121918624, rs121918625 View all (860 more)	30244534
Episodic ataxia	Episodic Ataxia	rs121908212, rs587776692, rs587776693, rs121908216, rs121908215, rs121908233, rs121908226, rs587776694, rs587776695, rs121908225, rs121909323, rs121909324, rs121908227, rs121909326, rs121908236 View all (58 more)
Ethylmalonic encephalopathy	Ethylmalonic encephalopathy	rs28940289, rs119103249, rs387906987, rs267605525, rs863223954, rs745656120, rs863223955, rs935855792, rs756235299, rs1555762722, rs763799125, rs769259233, rs1284200516, rs1555765701, rs1555765689 View all (10 more)	23934111
Febrile seizures	Febrile Convulsions	rs121909761, rs121909672, rs121909673, rs121909674, rs1561645243, rs267606837, rs796052510, rs1553553485, rs1554097890, rs1554101202, rs1554098226, rs765574676, rs1045493304
Hypothyroidism	Hypothyroidism	rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912 View all (22 more)
Left ventricular noncompaction	Left ventricular noncompaction	rs121913654, rs730880850, rs386134243, rs397515482, rs138110910, rs730880336, rs730880856, rs794729390, rs886037900, rs1114167338, rs1555338658
Mental retardation	Intellectual Disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)	23934111
Microcephaly	Microcephaly	rs397704721, rs267607176, rs267607177, rs397704725, rs267606717, rs267606718, rs199422202, rs121434311, rs199422203, rs199422126, rs387906274, rs121434305, rs199422125, rs199422135, rs189678019 View all (280 more)
Myopia	Myopia	rs387907109, rs146936371, rs587776903, rs786205127, rs398122836, rs199624584, rs587777625, rs786205216, rs758872875, rs764211125, rs1135402746, rs765658563, rs1555941129, rs1555941116, rs199923805 View all (6 more)
Precocious puberty	Precocious Puberty	rs879255238, rs879255239, rs879255240, rs1264639964, rs1566764505
Prostate cancer	Malignant neoplasm of prostate, Prostate carcinoma	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	23535732, 29892016
Seizure	Tonic - clonic seizures	rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061 View all (179 more)
Ventricular septal defect	Ventricular Septal Defects	rs104894073, rs387906775
West syndrome	West Syndrome	rs267606715, rs267608421, rs727503974, rs786205598, rs794727152, rs796053134, rs796053162, rs1057517854, rs267608618, rs1555952078, rs1555954752, rs749975104

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Source
Unknown
Asthma	Asthma	ClinVar
Renal dysplasia	Renal Cell Dysplasia, Renal dysplasia	ClinVar
Developmental And Epileptic Encephalopathy	genetic developmental and epileptic encephalopathy	GenCC
Schizophrenia	Schizophrenia	GWAS
Mental Depression	Mental Depression	GWAS

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Kidney Injury	Associate	34916780
Asthma	Associate	35470728
Bicuspid Aortic Valve Disease	Associate	36071494
Brain Diseases	Associate	34930159
Carcinogenesis	Associate	26077989
Carcinoma Renal Cell	Inhibit	25277184
Carcinoma Renal Cell	Associate	33173411
Cholangiocarcinoma	Associate	36635225
Drug Hypersensitivity	Associate	32603359
Eyelid Diseases	Associate	38088023
Glioblastoma	Associate	26077989, 28100038
Glioma	Associate	26077989
Glomerulosclerosis Focal Segmental	Associate	34930159
Hypoxia	Associate	34916780
Inflammation	Associate	32757662
Ischemia	Associate	34916780
Melanoma	Associate	33118318
Muscular Dystrophies	Associate	36352383
Myotonic Dystrophy	Associate	36352383
Nephrotic Syndrome	Associate	34930159
Neurologic Manifestations	Associate	36352383
Osteoarthritis	Stimulate	32757662
Osteosarcoma	Associate	35102149
Proteinuria	Associate	34930159
Reperfusion Injury	Associate	34916780
Smooth Muscle Tumor	Associate	35470728

TRIM8 (tripartite motif containing 8)