Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
81570
Gene name Gene Name - the full gene name approved by the HGNC.
ClpB family mitochondrial disaggregase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CLPB
Synonyms (NCBI Gene) Gene synonyms aliases
ANKCLB, ANKCLP, HSP78, MEGCANN, MGCA7, MGCA7A, SCN9, SKD3
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.4
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the ATP-ases associated with diverse cellular activities (AAA+) superfamily. Members of this superfamily form ring-shaped homo-hexamers and have highly conserved ATPase domains that are involved in various processes including DNA repl
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs144078282 T>A,C Likely-pathogenic, pathogenic-likely-pathogenic Coding sequence variant, genic downstream transcript variant, missense variant
rs150857620 T>A,C Pathogenic Genic downstream transcript variant, missense variant, coding sequence variant
rs185461628 G>A Pathogenic Stop gained, coding sequence variant
rs200203460 G>A,C,T Pathogenic Genic downstream transcript variant, missense variant, stop gained, coding sequence variant, synonymous variant
rs374473067 C>A Pathogenic Stop gained, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT052510 hsa-let-7a-5p CLASH 23622248
MIRT043166 hsa-miR-324-5p CLASH 23622248
MIRT724068 hsa-miR-3606-3p HITS-CLIP 19536157
MIRT724067 hsa-miR-513a-3p HITS-CLIP 19536157
MIRT724066 hsa-miR-513c-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0005515 Function Protein binding IPI 19615732, 25416956, 31522117, 33961781
GO:0005524 Function ATP binding IEA
GO:0005737 Component Cytoplasm IBA
GO:0005739 Component Mitochondrion HTP 34800366
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616254 30664 ENSG00000162129
Protein
UniProt ID Q9H078
Protein name Mitochondrial disaggregase (EC 3.6.1.-) (Suppressor of potassium transport defect 3) [Cleaved into: Mitochondrial disaggregase, cleaved form]
Protein function Functions as a regulatory ATPase and participates in secretion/protein trafficking process. Has ATP-dependent protein disaggregase activity and is required to maintain the solubility of key mitochondrial proteins (PubMed:32573439, PubMed:3411584
PDB 7TTR , 7TTS , 7US2 , 7XBK , 7XC5 , 8DEH , 8FDS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 111 197 Ankyrin repeats (3 copies) Repeat
PF13857 Ank_5 249 306 Repeat
PF07724 AAA_2 372 565 AAA domain (Cdc48 subfamily) Domain
PF10431 ClpB_D2-small 572 651 C-terminal, D2-small domain, of ClpB protein Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed (at protein level) (PubMed:25597511). Expressed in fetal, as well as in adult tissues, with highest levels in adult brain, including thalamus, hippocampus, occipital cortex and parietal cortex. Low expression in granul
Sequence
MLGSLVLRRKALAPRLLLRLLRSPTLRGHGGASGRNVTTGSLGEPQWLRVATGGRPGTSP
ALFSGRGAATGGRQGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAA
ALVVHCYSKSPSNKDAALLEAARANNMQEVSRLLSEGADVNAKHRLGWTALMVAAINRNN
SVVQVLLAAGADPNLGD
DFSSVYKTAKEQGIHSLEDGGQDGASRHITNQWTSALEFRRWL
GLPAGVLITREDDFNNRLNNRASFKGCTALHYAVLADDYRTVKELLDGGANPLQRNEMGH
TPLDYA
REGEVMKLLRTSEAKYQEKQRKREAEERRRFPLEQRLKEHIIGQESAIATVGAA
IRRKENGWYDEEHPLVFLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEV
AKFIGSPPGYVGHEEGGQLTKKLKQCPNAVVLFDEVDKAHPDVLTIMLQLFDEGRLTDGK
GKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGDVQISDKITISKNF
KENVIRPILKAHFRRDEFLGRINEI
VYFLPFCHSELIQLVNKELNFWAKRAKQRHNITLL
WDREVADVLVDGYNVHYGARSIKHEVERRVVNQLAAAYEQDLLPGGCTLRI
TVEDSDKQL
LKSPELPSPQAEKRLPKLRLEIIDKDSKTRRLDIRAPLHPEKVCNTI
Sequence length 707
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Longevity regulating pathway - multiple species  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
3-Methylglutaconic aciduria 3-methylglutaconic aciduria, type VIIB rs1565424666, rs759500860, rs185461628, rs748010262, rs780554501, rs786205138, rs368496010, rs144078282, rs200203460, rs786205139, rs876657402, rs777202372, rs974377052, rs1555087619 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Acute Myeloid Leukemia Leukemia, Acute Myeloid CLPB loss suppresses AML cell growth in vitro and in vivo. 31048321 CBGDA
Congenital Neutropenia Neutropenia, severe congenital, 2, autosomal dominant, Neutropenia, severe congenital, 9, autosomal dominant N/A N/A ClinVar
Leigh Syndrome Leigh syndrome N/A N/A GenCC
Neutropenia neutropenia, severe congenital, 9, autosomal dominant N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
3 Methylglutaconic Aciduria Associate 32573439, 34115842, 35247700, 36074910, 37041140
Cataract Associate 34115842, 36074910
Death Associate 37041140
Genetic Diseases Inborn Associate 36074910
Heredodegenerative Disorders Nervous System Associate 34115842
Immunologic Deficiency Syndromes Associate 35499078
Infertility Associate 36074910
Leukemia Myeloid Acute Stimulate 35247700
Mitochondrial Diseases Associate 32573439, 34115842
Mitochondrial Myopathy with a Defect in Mitochondrial Protein Transport Associate 35499078