Gene Gene information from NCBI Gene database.
Entrez ID 81552
Gene name VOPP1 WW domain binding protein
Gene symbol VOPP1
Synonyms (NCBI Gene)
ECOPGASPWBP1L2
Chromosome 7
Chromosome location 7p11.2
miRNA miRNA information provided by mirtarbase database.
649
miRTarBase ID miRNA Experiments Reference
MIRT004541 hsa-miR-218-5p qRT-PCR 19168627
MIRT004541 hsa-miR-218-5p MicroarrayqRT-PCR 19168627
MIRT004541 hsa-miR-218-5p Luciferase reporter assayqRT-PCR 19890957
MIRT046506 hsa-miR-15b-5p CLASH 23622248
MIRT044677 hsa-miR-320a CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 30285739, 33961781
GO:0005764 Component Lysosome IDA 30285739
GO:0005764 Component Lysosome IEA
GO:0005765 Component Lysosomal membrane IEA
GO:0005768 Component Endosome IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611915 34518 ENSG00000154978
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96AW1
Protein name WW domain binding protein VOPP1 (EGFR-coamplified and overexpressed protein) (ECop) (Glioblastoma-amplified secreted protein) (Putative NF-kappa-B-activating protein 055N) (Vesicular, overexpressed in cancer, prosurvival protein 1)
Protein function Increases the transcriptional activity of NFKB1 by facilitating its nuclear translocation, DNA-binding and associated apoptotic response, when overexpressed (PubMed:15735698). May sequester WWOX in lysosomal vesicles and thereby regulate WWOX ro
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed with highest levels in thymus and ovary. {ECO:0000269|PubMed:11916499}.
Sequence
MRRQPAKVAALLLGLLLECTEAKKHCWYFEGLYPTYYICRSYEDCCGSRCCVRALSIQRL
WYFWFLLMMGVLFCCGAGFFIRRRMYPPPLIEEPAFNVSYTRQPPNPGPGAQQPGPPYYT
DPGGPGMNPVGNSMAMAFQVPPNSPQGSVACPPPPAYCNTPPPPYEQVVKAK
Sequence length 172
Interactions View interactions