Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
81552
Gene name Gene Name - the full gene name approved by the HGNC.
VOPP1 WW domain binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
VOPP1
Synonyms (NCBI Gene) Gene synonyms aliases
ECOP, GASP, WBP1L2
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p11.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004541 hsa-miR-218-5p qRT-PCR 19168627
MIRT004541 hsa-miR-218-5p Microarray, qRT-PCR 19168627
MIRT004541 hsa-miR-218-5p Luciferase reporter assay, qRT-PCR 19890957
MIRT046506 hsa-miR-15b-5p CLASH 23622248
MIRT044677 hsa-miR-320a CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005768 Component Endosome IDA
GO:0030659 Component Cytoplasmic vesicle membrane IDA 20571887
GO:0031301 Component Integral component of organelle membrane IBA 21873635
GO:0031301 Component Integral component of organelle membrane IDA 20571887
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611915 34518 ENSG00000154978
Protein
UniProt ID Q96AW1
Protein name WW domain binding protein VOPP1 (EGFR-coamplified and overexpressed protein) (ECop) (Glioblastoma-amplified secreted protein) (Putative NF-kappa-B-activating protein 055N) (Vesicular, overexpressed in cancer, prosurvival protein 1)
Protein function Increases the transcriptional activity of NFKB1 by facilitating its nuclear translocation, DNA-binding and associated apoptotic response, when overexpressed (PubMed:15735698). May sequester WWOX in lysosomal vesicles and thereby regulate WWOX ro
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed with highest levels in thymus and ovary. {ECO:0000269|PubMed:11916499}.
Sequence
MRRQPAKVAALLLGLLLECTEAKKHCWYFEGLYPTYYICRSYEDCCGSRCCVRALSIQRL
WYFWFLLMMGVLFCCGAGFFIRRRMYPPPLIEEPAFNVSYTRQPPNPGPGAQQPGPPYYT
DPGGPGMNPVGNSMAMAFQVPPNSPQGSVACPPPPAYCNTPPPPYEQVVKAK
Sequence length 172
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2) rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 18206229
Unknown
Disease term Disease name Evidence References Source
Myocardial infarction Myocardial Infarction 21211798 ClinVar
Oligodendroglioma Oligodendroglioma GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 21519330
Breast Neoplasms Associate 30285739
Carcinogenesis Associate 33845647
Carcinoma Hepatocellular Associate 32083568, 33845647
Carcinoma Non Small Cell Lung Associate 36001806
Carcinoma Squamous Cell Associate 21519330
Carcinoma Squamous Cell Stimulate 32083568
Esophageal Squamous Cell Carcinoma Associate 33345608
Glioblastoma Stimulate 32083568
Hereditary Breast and Ovarian Cancer Syndrome Associate 30285739