Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	81551
Gene name	Stathmin 4
Gene symbol	STMN4
Synonyms (NCBI Gene)	RB3
Chromosome	8
Chromosome location	8p21.2

Show/Hide all (55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT708634	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT708633	hsa-miR-29b-1-5p	HITS-CLIP	19536157
MIRT708632	hsa-miR-452-3p	HITS-CLIP	19536157
MIRT708631	hsa-miR-4279	HITS-CLIP	19536157
MIRT708630	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT708634	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT708633	hsa-miR-29b-1-5p	HITS-CLIP	19536157
MIRT708632	hsa-miR-452-3p	HITS-CLIP	19536157
MIRT708631	hsa-miR-4279	HITS-CLIP	19536157
MIRT708630	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT708634	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT708633	hsa-miR-29b-1-5p	HITS-CLIP	19536157
MIRT708632	hsa-miR-452-3p	HITS-CLIP	19536157
MIRT708631	hsa-miR-4279	HITS-CLIP	19536157
MIRT708630	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT708634	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT708633	hsa-miR-29b-1-5p	HITS-CLIP	19536157
MIRT708632	hsa-miR-452-3p	HITS-CLIP	19536157
MIRT708631	hsa-miR-4279	HITS-CLIP	19536157
MIRT708630	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT2119550	hsa-miR-1224-3p	CLIP-seq
MIRT2119551	hsa-miR-1260	CLIP-seq
MIRT2119552	hsa-miR-1260b	CLIP-seq
MIRT2119553	hsa-miR-1280	CLIP-seq
MIRT2635601	hsa-miR-1184	CLIP-seq
MIRT2635602	hsa-miR-1254	CLIP-seq
MIRT2635603	hsa-miR-149	CLIP-seq
MIRT2635604	hsa-miR-1913	CLIP-seq
MIRT2635605	hsa-miR-205	CLIP-seq
MIRT2635606	hsa-miR-2117	CLIP-seq
MIRT2635607	hsa-miR-3064-5p	CLIP-seq
MIRT2635608	hsa-miR-3116	CLIP-seq
MIRT2635609	hsa-miR-3168	CLIP-seq
MIRT2635610	hsa-miR-3173-5p	CLIP-seq
MIRT2635611	hsa-miR-3189-5p	CLIP-seq
MIRT2635612	hsa-miR-324-3p	CLIP-seq
MIRT2635613	hsa-miR-326	CLIP-seq
MIRT2635614	hsa-miR-330-5p	CLIP-seq
MIRT2635615	hsa-miR-3620	CLIP-seq
MIRT2635616	hsa-miR-3652	CLIP-seq
MIRT2635617	hsa-miR-3664-5p	CLIP-seq
MIRT2635618	hsa-miR-412	CLIP-seq
MIRT2635619	hsa-miR-4299	CLIP-seq
MIRT2635620	hsa-miR-4430	CLIP-seq
MIRT2635621	hsa-miR-4456	CLIP-seq
MIRT2635622	hsa-miR-4466	CLIP-seq
MIRT2635623	hsa-miR-4505	CLIP-seq
MIRT2635624	hsa-miR-4522	CLIP-seq
MIRT2635625	hsa-miR-4670-3p	CLIP-seq
MIRT2635626	hsa-miR-4758-3p	CLIP-seq
MIRT2635627	hsa-miR-4794	CLIP-seq
MIRT2635628	hsa-miR-548q	CLIP-seq
MIRT2635629	hsa-miR-550a	CLIP-seq
MIRT2635630	hsa-miR-661	CLIP-seq
MIRT2635631	hsa-miR-675	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0007019	Process	Microtubule depolymerization	IBA
GO:0015631	Function	Tubulin binding	IBA
GO:0030424	Component	Axon	IEA
GO:0030426	Component	Growth cone	IEA
GO:0031110	Process	Regulation of microtubule polymerization or depolymerization	IBA
GO:0031110	Process	Regulation of microtubule polymerization or depolymerization	IEA
GO:0031175	Process	Neuron projection development	IBA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IBA

MIM	HGNC	e!Ensembl
620740	16078	ENSG00000015592

Q9H169

Protein name

Stathmin-4 (Stathmin-like protein B3) (RB3)

Protein function

Exhibits microtubule-destabilizing activity.

PDB

6BR1 , 6BRF , 6BRY , 6NNG , 6O5M , 6O5N , 6O61 , 6PC4 , 7CPD , 9F07

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00836	Stathmin	49 → 184	Stathmin family	Family

Sequence

MTLAAYKEKMKELPLVSLFCSCFLADPLNKSSYKYEADTVDLNWCVISDMEVIELNKCTS
GQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELLKHLAEKR
EHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKN
KELKEEASR

Sequence length

189

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Cardiomyopathy Restrictive	Associate	26931105	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	37093091	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	34155404	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	35610288	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	35610288	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Inhibit	37093091	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Associate	37093091	★★★★★ ★☆☆☆☆ Found in Text Mining only

STMN4 (stathmin 4)