Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
81543
Gene name Gene Name - the full gene name approved by the HGNC.
Leucine rich repeat containing 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LRRC3
Synonyms (NCBI Gene) Gene synonyms aliases
C21orf102, C21orf30, LRRC3DN
Chromosome Chromosome number
21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q22.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1119506 hsa-miR-1299 CLIP-seq
MIRT1119507 hsa-miR-1304 CLIP-seq
MIRT1119508 hsa-miR-2355-5p CLIP-seq
MIRT1119509 hsa-miR-24 CLIP-seq
MIRT1119510 hsa-miR-3122 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17474147
GO:0005886 Component Plasma membrane IBA
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617620 14965 ENSG00000160233
Protein
UniProt ID Q9BY71
Protein name Leucine-rich repeat-containing protein 3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01462 LRRNT 32 63 Leucine rich repeat N-terminal domain Family
PF13855 LRR_8 65 113 Leucine rich repeat Repeat
PF00560 LRR_1 114 136 Leucine Rich Repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Widely expressed; detected in testis, lung, small intestine, breast, brain, heart, bone marrow, placenta, colon, fetal brain, liver, fetal liver, thymus, salivary gland, spinal cord, spleen, trachea and adrenal gland.
Sequence
MGTVRPPRPSLLLVSTRESCLFLLFCLHLGAACPQPCRCPDHAGAVAVFCSLRGLQEVPE
DIP
ANTVLLKLDANKISHLPDGAFQHLHRLRELDLSHNAIEAIGSATFAGLAGGLRLLDL
SYNRIQRIPKDALGKL
SAKIRLSHNPLHCECALQEALWELKLDPDSVDEIACHTSVQEEF
VGKPLVQALDAGASLCSVPHRTTDVAMLVTMFGWFAMVIAYVVYYVRHNQEDARRHLEYL
KSLPSAPASKDPIGPGP
Sequence length 257
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Intracranial Aneurysm Intracranial aneurysm N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Polycythemia Vera Associate 28427458