DCSTAMP (dendrocyte expressed seven transmembrane protein)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 81501
Gene name Dendrocyte expressed seven transmembrane protein
Gene symbol DCSTAMP
Synonyms (NCBI Gene)
FINDTM7SF4hDC-STAMP
Chromosome 8
Chromosome location 8q22.3
Summary This gene encodes a seven-pass transmembrane protein that is primarily expressed in dendritic cells. The encoded protein is involved in a range of immunological functions carried out by dendritic cells. This protein plays a role in osteoclastogenesis and
miRNA miRNA information provided by mirtarbase database.
3
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (3)
miRTarBase ID miRNA Experiments Reference
MIRT018900 hsa-miR-335-5p Microarray 18185580
MIRT030239 hsa-miR-26b-5p Microarray 19088304
MIRT053788 hsa-miR-452-5p MicroarrayqRT-PCR 22952876
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
38
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (38)
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 20546900
GO:0005768 Component Endosome IEA
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
605933 18549 ENSG00000164935
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H295
Protein name Dendritic cell-specific transmembrane protein (DC-STAMP) (hDC-STAMP) (Dendrocyte-expressed seven transmembrane protein) (IL-four-induced protein) (FIND) (Transmembrane 7 superfamily member 4)
Protein function Probable cell surface receptor that plays several roles in cellular fusion, cell differentiation, bone and immune homeostasis. Plays a role in TNFSF11-mediated osteoclastogenesis. Cooperates with OCSTAMP in modulating cell-cell fusion in both os
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07782 DC_STAMP 242 → 421 DC-STAMP-like protein Family
Tissue specificity TISSUE SPECIFICITY: Preferentially expressed by dendritic cells (DCs). Detected in both immature and mature DCs. Highly expressed in lymph nodes, lung, kidney and liver. Expressed at lower levels in pancreas, bone marrow, spleen, leukocytes, in freshly is
Sequence 
MGIWTSGTDIFLSLWEIYVSPRSPGWMDFIQHLGVCCLVALISVGLLSVAACWFLPSIIA
AAASWIITCVLLCCSKHARCFILLVFLSCGLREGRNALIAAGTGIVILGHVENIFHNFKG
LLDGMTCNLRAKSFSIHFPLLKKYIEAIQWIYGLATPLSVFDDLVSWNQTLAVSLFSPSH
VLEAQLNDSKGEVLSVLYQMATTTEVLSSLGQKLLAFAGLSLVLLGTGLFMKRFLGPCGW
KYENIYITRQFVQFDERERHQQRPCVLPLNKEERRKYVIIPTFWPTPKERKNLGLFFLPI
LIHLCIWVLFAAVDYLLYRLIFSVSKQFQSLPGFEVHLKLHGEKQGTQDIIHDSSFNISV
FEPNCIPKPKFLLSETWVPLSVILLILVMLGLLSSILMQLKILVSASFYPSVERKRIQYL
HAKLLKKRSKQPLGEVKRRLSLYLTKIHFWLPVLKMIRKKQMDMASADKS
Sequence length 470
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
4
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (4)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Adrenocortical carcinoma, hereditary Benign rs3802204 RCV005921514
Cholangiocarcinoma Benign rs3802204 RCV005921517
Colorectal cancer Benign rs3802204 RCV005921516
Malignant lymphoma, large B-cell, diffuse Benign rs3802204 RCV005921515
Show/Hide Text Mining Associations (10)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Bisphosphonate Associated Osteonecrosis of the Jaw Associate 28587628
Breast Neoplasms Associate 26636523
Hip Injuries Associate 25151085
HIV Infections Associate 37404829
Hyperostosis corticalis deformans juvenilis Associate 25891874
Knee Injuries Associate 25151085
Osteitis Deformans Associate 21623375, 26636523, 29145829, 30705363
Periodontitis Associate 32374812
Thyroid Cancer Papillary Associate 21179278, 26636523
Tooth Resorption Associate 32887359