DCSTAMP (dendrocyte expressed seven transmembrane protein)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
81501
Gene name Gene Name - the full gene name approved by the HGNC.
Dendrocyte expressed seven transmembrane protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DCSTAMP
Synonyms (NCBI Gene) Gene synonyms aliases
FIND, TM7SF4, hDC-STAMP
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q22.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a seven-pass transmembrane protein that is primarily expressed in dendritic cells. The encoded protein is involved in a range of immunological functions carried out by dendritic cells. This protein plays a role in osteoclastogenesis and
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(3)
miRTarBase ID miRNA Experiments Reference
MIRT018900 hsa-miR-335-5p Microarray 18185580
MIRT030239 hsa-miR-26b-5p Microarray 19088304
MIRT053788 hsa-miR-452-5p Microarray, qRT-PCR 22952876
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(21)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20546900
GO:0005789 Component Endoplasmic reticulum membrane IBA 21873635
GO:0005789 Component Endoplasmic reticulum membrane IDA 15601667, 20546900
GO:0005886 Component Plasma membrane IEA
GO:0009986 Component Cell surface IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
605933 18549 ENSG00000164935
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9H295
Protein name Dendritic cell-specific transmembrane protein (DC-STAMP) (hDC-STAMP) (Dendrocyte-expressed seven transmembrane protein) (IL-four-induced protein) (FIND) (Transmembrane 7 superfamily member 4)
Protein function Probable cell surface receptor that plays several roles in cellular fusion, cell differentiation, bone and immune homeostasis. Plays a role in TNFSF11-mediated osteoclastogenesis. Cooperates with OCSTAMP in modulating cell-cell fusion in both os
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07782 DC_STAMP 242 → 421 DC-STAMP-like protein Family
Tissue specificity TISSUE SPECIFICITY: Preferentially expressed by dendritic cells (DCs). Detected in both immature and mature DCs. Highly expressed in lymph nodes, lung, kidney and liver. Expressed at lower levels in pancreas, bone marrow, spleen, leukocytes, in freshly is
Sequence 
MGIWTSGTDIFLSLWEIYVSPRSPGWMDFIQHLGVCCLVALISVGLLSVAACWFLPSIIA
AAASWIITCVLLCCSKHARCFILLVFLSCGLREGRNALIAAGTGIVILGHVENIFHNFKG
LLDGMTCNLRAKSFSIHFPLLKKYIEAIQWIYGLATPLSVFDDLVSWNQTLAVSLFSPSH
VLEAQLNDSKGEVLSVLYQMATTTEVLSSLGQKLLAFAGLSLVLLGTGLFMKRFLGPCGW
KYENIYITRQFVQFDERERHQQRPCVLPLNKEERRKYVIIPTFWPTPKERKNLGLFFLPI
LIHLCIWVLFAAVDYLLYRLIFSVSKQFQSLPGFEVHLKLHGEKQGTQDIIHDSSFNISV
FEPNCIPKPKFLLSETWVPLSVILLILVMLGLLSSILMQLKILVSASFYPSVERKRIQYL
HAKLLKKRSKQPLGEVKRRLSLYLTKIHFWLPVLKMIRKKQMDMASADKS
Sequence length 470
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Paget disease Osteitis Deformans, Paget Disease rs796051862, rs796051869, rs796051870, rs796052213, rs1555767678, rs869025582 21623375, 20436471
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Endometriosis Endometriosis 20864642 ClinVar
Diabetes Diabetes GWAS
Show/Hide Text Mining Associations (10)
Associations from Text Mining
Disease Name Relationship Type References
Bisphosphonate Associated Osteonecrosis of the Jaw Associate 28587628
Breast Neoplasms Associate 26636523
Hip Injuries Associate 25151085
HIV Infections Associate 37404829
Hyperostosis corticalis deformans juvenilis Associate 25891874
Knee Injuries Associate 25151085
Osteitis Deformans Associate 21623375, 26636523, 29145829, 30705363
Periodontitis Associate 32374812
Thyroid Cancer Papillary Associate 21179278, 26636523
Tooth Resorption Associate 32887359