POLR2M (RNA polymerase II subunit M)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID 81488
Gene name RNA polymerase II subunit M
Gene symbol POLR2M
Synonyms (NCBI Gene)
GCOM1GRINL1AGdownGdown1
Chromosome 15
Chromosome location 15q21.3
Summary This gene encodes a subunit of a specific form of RNA polymerase II termed Pol II(G). The encoded protein may act as a negative regulator of transcriptional activation by the Mediator complex. Alternative splicing results in multiple transcript variants.
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT043380 hsa-miR-331-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (13)
GO ID Ontology Definition Evidence Reference
GO:0000428 Component DNA-directed RNA polymerase complex IEA
GO:0000993 Function RNA polymerase II complex binding IDA 26789250
GO:0003711 Function Transcription elongation factor activity IEA
GO:0005634 Component Nucleus IEA
GO:0005635 Component Nuclear envelope IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
606485 14862 ENSG00000255529
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0CAP2
Protein name DNA-directed RNA polymerase II subunit GRINL1A (DNA-directed RNA polymerase II subunit M) (Glutamate receptor-like protein 1A)
Protein function [Isoform 1]: Appears to be a stable component of the Pol II(G) complex form of RNA polymerase II (Pol II). Pol II synthesizes mRNA precursors and many functional non-coding RNAs and is the central component of the basal RNA polymerase II transcr
PDB 6DRD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15328 GCOM2 27 → 241 Putative GRINL1B complex locus protein 2 Family
Tissue specificity TISSUE SPECIFICITY: Detected in adult an fetal brain. Detected in heart, kidney, skeletal muscle, small intestine, lung, prostate and testis. {ECO:0000269|PubMed:15233991}.
Sequence 
MCSLPRGFEPQAPEDLAQRSLVELREMLKRQERLLRNEKFICKLPDKGKKIFDSFAKLKA
AIAECEEVRRKSELFNPVSLDCKLRQKAIAEVDVGTDKAQNSDPILDTSSLVPGCSSVDN
IKSSQTSQNQGLGRPTLEGDEETSEVEYTVNKGPASSNRDRVPPSSEASEHHPRHRVSSQ
AEDTSSSFDNLFIDRLQRITIADQGEQQSEENASTKNLTGLSSGTEKKPHYMEVLEMRAK
NPVPQLRKFKTNVLPFRQNDSSSHCQKSGSPISSEERRRRDKQHLDDITAARLLPLHHMP
TQLLSIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYNPEGESSGRYREVRDED
DDWSSDEF
Sequence length 368
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6EEV4
Protein name DNA-directed RNA polymerase II subunit GRINL1A, isoforms 4/5 (DNA-directed RNA polymerase II subunit M, isoforms 4/5)
Family and domains
Sequence 
MATPARAPESPPSADPALVAGPAEEAECPPPRQPQPAQNVLAAPRLRAPSSRGLGAAEFG
GAAGNVEAPGETFAQRVSWGPAESPPGSFSSSSLGAPLPSRTLFPSLEGDFDSVTFASVL
RASGRRACCGRAVPLPGQKIHLQIARQR
Sequence length 148
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG 
  RNA polymerase
Nucleotide excision repair