Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8148
Gene name Gene Name - the full gene name approved by the HGNC.	TATA-box binding protein associated factor 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TAF15
Synonyms (NCBI Gene) Gene synonyms aliases	Npl3, RBP56, TAF2N, TAFII68
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the TET family of RNA-binding proteins. The encoded protein plays a role in RNA polymerase II gene transcription as a component of a distinct subset of multi-subunit transcription initiation factor TFIID complexes. Translocat

Show/Hide all(134)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021732	hsa-miR-132-3p	Microarray	17612493
MIRT025067	hsa-miR-181a-5p	Microarray	17612493
MIRT030412	hsa-miR-24-3p	Microarray	19748357
MIRT031463	hsa-miR-16-5p	Proteomics	18668040
MIRT048160	hsa-miR-196a-5p	CLASH	23622248
MIRT047604	hsa-miR-10a-5p	CLASH	23622248
MIRT046039	hsa-miR-125b-5p	CLASH	23622248
MIRT044517	hsa-miR-320a	CLASH	23622248
MIRT041143	hsa-miR-501-5p	CLASH	23622248
MIRT040091	hsa-miR-615-3p	CLASH	23622248
MIRT040091	hsa-miR-615-3p	CLASH	23622248
MIRT040091	hsa-miR-615-3p	CLASH	23622248
MIRT037061	hsa-miR-877-3p	CLASH	23622248
MIRT1409126	hsa-miR-1246	CLIP-seq
MIRT1409127	hsa-miR-1271	CLIP-seq
MIRT1409128	hsa-miR-132	CLIP-seq
MIRT1409129	hsa-miR-1323	CLIP-seq
MIRT1409130	hsa-miR-137	CLIP-seq
MIRT1409131	hsa-miR-15a	CLIP-seq
MIRT1409132	hsa-miR-15b	CLIP-seq
MIRT1409133	hsa-miR-16	CLIP-seq
MIRT1409134	hsa-miR-181a	CLIP-seq
MIRT1409135	hsa-miR-181b	CLIP-seq
MIRT1409136	hsa-miR-181c	CLIP-seq
MIRT1409137	hsa-miR-181d	CLIP-seq
MIRT1409138	hsa-miR-182	CLIP-seq
MIRT1409139	hsa-miR-195	CLIP-seq
MIRT1409140	hsa-miR-2110	CLIP-seq
MIRT1409141	hsa-miR-212	CLIP-seq
MIRT1409142	hsa-miR-214	CLIP-seq
MIRT1409143	hsa-miR-216a	CLIP-seq
MIRT1409144	hsa-miR-25	CLIP-seq
MIRT1409145	hsa-miR-296-3p	CLIP-seq
MIRT1409146	hsa-miR-3128	CLIP-seq
MIRT1409147	hsa-miR-3150a-3p	CLIP-seq
MIRT1409148	hsa-miR-3175	CLIP-seq
MIRT1409149	hsa-miR-32	CLIP-seq
MIRT1409150	hsa-miR-3619-5p	CLIP-seq
MIRT1409151	hsa-miR-363	CLIP-seq
MIRT1409152	hsa-miR-367	CLIP-seq
MIRT1409153	hsa-miR-3912	CLIP-seq
MIRT1409154	hsa-miR-3919	CLIP-seq
MIRT1409155	hsa-miR-3978	CLIP-seq
MIRT1409156	hsa-miR-424	CLIP-seq
MIRT1409157	hsa-miR-4261	CLIP-seq
MIRT1409158	hsa-miR-4262	CLIP-seq
MIRT1409159	hsa-miR-4434	CLIP-seq
MIRT1409160	hsa-miR-4509	CLIP-seq
MIRT1409161	hsa-miR-4516	CLIP-seq
MIRT1409162	hsa-miR-4668-3p	CLIP-seq
MIRT1409163	hsa-miR-4690-5p	CLIP-seq
MIRT1409164	hsa-miR-4716-3p	CLIP-seq
MIRT1409165	hsa-miR-4717-5p	CLIP-seq
MIRT1409166	hsa-miR-4720-5p	CLIP-seq
MIRT1409167	hsa-miR-4742-5p	CLIP-seq
MIRT1409168	hsa-miR-4756-3p	CLIP-seq
MIRT1409169	hsa-miR-4775	CLIP-seq
MIRT1409170	hsa-miR-4799-3p	CLIP-seq
MIRT1409171	hsa-miR-497	CLIP-seq
MIRT1409172	hsa-miR-520d-5p	CLIP-seq
MIRT1409173	hsa-miR-524-5p	CLIP-seq
MIRT1409174	hsa-miR-543	CLIP-seq
MIRT1409175	hsa-miR-548c-3p	CLIP-seq
MIRT1409176	hsa-miR-548o	CLIP-seq
MIRT1409177	hsa-miR-579	CLIP-seq
MIRT1409178	hsa-miR-625	CLIP-seq
MIRT1409179	hsa-miR-668	CLIP-seq
MIRT1409180	hsa-miR-761	CLIP-seq
MIRT1409181	hsa-miR-92a	CLIP-seq
MIRT1409182	hsa-miR-92b	CLIP-seq
MIRT1409183	hsa-miR-939	CLIP-seq
MIRT1409184	hsa-miR-96	CLIP-seq
MIRT1409129	hsa-miR-1323	CLIP-seq
MIRT1409131	hsa-miR-15a	CLIP-seq
MIRT1409132	hsa-miR-15b	CLIP-seq
MIRT1409133	hsa-miR-16	CLIP-seq
MIRT1409139	hsa-miR-195	CLIP-seq
MIRT1409142	hsa-miR-214	CLIP-seq
MIRT1409143	hsa-miR-216a	CLIP-seq
MIRT1409150	hsa-miR-3619-5p	CLIP-seq
MIRT1409156	hsa-miR-424	CLIP-seq
MIRT1409162	hsa-miR-4668-3p	CLIP-seq
MIRT1409163	hsa-miR-4690-5p	CLIP-seq
MIRT1409165	hsa-miR-4717-5p	CLIP-seq
MIRT1409167	hsa-miR-4742-5p	CLIP-seq
MIRT1409169	hsa-miR-4775	CLIP-seq
MIRT2122704	hsa-miR-4777-5p	CLIP-seq
MIRT1409171	hsa-miR-497	CLIP-seq
MIRT2122705	hsa-miR-518d-5p	CLIP-seq
MIRT2122706	hsa-miR-519b-5p	CLIP-seq
MIRT2122707	hsa-miR-519c-5p	CLIP-seq
MIRT2122708	hsa-miR-520c-5p	CLIP-seq
MIRT2122709	hsa-miR-526a	CLIP-seq
MIRT1409175	hsa-miR-548c-3p	CLIP-seq
MIRT1409176	hsa-miR-548o	CLIP-seq
MIRT1409179	hsa-miR-668	CLIP-seq
MIRT1409180	hsa-miR-761	CLIP-seq
MIRT1409126	hsa-miR-1246	CLIP-seq
MIRT1409127	hsa-miR-1271	CLIP-seq
MIRT1409129	hsa-miR-1323	CLIP-seq
MIRT1409131	hsa-miR-15a	CLIP-seq
MIRT1409132	hsa-miR-15b	CLIP-seq
MIRT1409133	hsa-miR-16	CLIP-seq
MIRT1409134	hsa-miR-181a	CLIP-seq
MIRT1409135	hsa-miR-181b	CLIP-seq
MIRT1409136	hsa-miR-181c	CLIP-seq
MIRT1409137	hsa-miR-181d	CLIP-seq
MIRT1409138	hsa-miR-182	CLIP-seq
MIRT1409139	hsa-miR-195	CLIP-seq
MIRT1409142	hsa-miR-214	CLIP-seq
MIRT1409146	hsa-miR-3128	CLIP-seq
MIRT1409150	hsa-miR-3619-5p	CLIP-seq
MIRT1409153	hsa-miR-3912	CLIP-seq
MIRT1409154	hsa-miR-3919	CLIP-seq
MIRT1409156	hsa-miR-424	CLIP-seq
MIRT1409158	hsa-miR-4262	CLIP-seq
MIRT1409162	hsa-miR-4668-3p	CLIP-seq
MIRT1409163	hsa-miR-4690-5p	CLIP-seq
MIRT1409165	hsa-miR-4717-5p	CLIP-seq
MIRT1409166	hsa-miR-4720-5p	CLIP-seq
MIRT1409167	hsa-miR-4742-5p	CLIP-seq
MIRT1409168	hsa-miR-4756-3p	CLIP-seq
MIRT1409169	hsa-miR-4775	CLIP-seq
MIRT1409170	hsa-miR-4799-3p	CLIP-seq
MIRT1409171	hsa-miR-497	CLIP-seq
MIRT1409172	hsa-miR-520d-5p	CLIP-seq
MIRT1409173	hsa-miR-524-5p	CLIP-seq
MIRT1409174	hsa-miR-543	CLIP-seq
MIRT1409175	hsa-miR-548c-3p	CLIP-seq
MIRT1409176	hsa-miR-548o	CLIP-seq
MIRT1409177	hsa-miR-579	CLIP-seq
MIRT1409179	hsa-miR-668	CLIP-seq
MIRT1409180	hsa-miR-761	CLIP-seq
MIRT1409184	hsa-miR-96	CLIP-seq

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003712	Function	Transcription coregulator activity	IBA	21873635
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA	21873635
GO:0003723	Function	RNA binding	IDA	27378374
GO:0005515	Function	Protein binding	IPI	18509338, 19124016, 21988832, 23975937, 27460707
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	19124016
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	19124016
GO:0005737	Component	Cytoplasm	IDA	19124016
GO:0006366	Process	Transcription by RNA polymerase II	TAS
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	TAS	19124016
GO:0046872	Function	Metal ion binding	IEA
GO:0048255	Process	MRNA stabilization	IDA	27378374
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS

MIM	HGNC	e!Ensembl
601574	11547	ENSG00000270647

Protein

UniProt ID

Q92804

Protein name

TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56)

Protein function

RNA and ssDNA-binding protein that may play specific roles during transcription initiation at distinct promoters. Binds to ssRNA containing the consensus sequence 5'-AGGUAA-3' (PubMed:21256132). Can enter the preinitiation complex together with

PDB

2MMY , 8ONS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	236 → 314	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00641	zf-RanBP	354 → 385	Zn-finger in Ran binding protein and others	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Observed in all fetal and adult tissues.

Sequence

MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQ
SGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQS
GYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGS
QGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQG
LGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAI
DWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVC
PNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGG
DRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYG
GDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSG
YGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY

Sequence length

592

Interactions

View interactions

	KEGG		Reactome
	Basal transcription factors Transcriptional misregulation in cancer		RNA Polymerase II Pre-transcription Events Regulation of TP53 Activity through Phosphorylation RNA Polymerase II Promoter Escape RNA Polymerase II Transcription Pre-Initiation And Promoter Opening RNA Polymerase II Transcription Initiation RNA Polymerase II Transcription Initiation And Promoter Clearance

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Amyotrophic lateral sclerosis	Amyotrophic Lateral Sclerosis, Amyotrophic lateral sclerosis	rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733 View all (171 more)	26601740, 21438137
Chondrosarcoma	Chondrosarcoma	rs587776540, rs1586279285, rs886039356, rs1554578798, rs1817895168
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)	21364753
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	31374203

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Mental depression	Depressive disorder	ClinVar
Amyotrophic Lateral Sclerosis	amyotrophic lateral sclerosis	GenCC
Oligodendroglioma	Oligodendroglioma	GWAS

Show/Hide Text Mining Associations (28)

Disease Name	Relationship Type	References
Associations from Text Mining
AA amyloidosis	Associate	35643629
Adenocarcinoma of Lung	Associate	36261009
Amyotrophic Lateral Sclerosis	Associate	23755159, 26004182, 35643629, 37722062, 38492239
Bipolar Disorder	Associate	28291257
Breast Neoplasms	Associate	34908514, 36895010
Carcinogenesis	Associate	22081015
Carcinoma Squamous Cell	Associate	32871048
Cell Transformation Neoplastic	Stimulate	31020999
Chondrosarcoma	Associate	31020999
Chondrosarcoma Extraskeletal Myxoid	Associate	24508382, 31020999, 36948401
Frontotemporal Lobar Degeneration	Associate	23049996, 30755280
Heredodegenerative Disorders Nervous System	Associate	23049996
Leukemia	Associate	18620564
Leukemia T Cell	Associate	35182012
Liver Neoplasms	Associate	30398641
Malformations of Cortical Development Group I	Associate	28381165
Motor Neuron Disease	Associate	22081015
Nasopharyngeal Carcinoma	Associate	37257820
Neoplasm Metastasis	Associate	23874428, 36261009, 36948401
Neoplasms	Associate	18620564, 23049996, 24267890, 28945358, 31020999, 33674598
Neoplasms	Stimulate	37037864
Neurodegenerative Diseases	Associate	25375143, 35643629, 38492239
Osteoporosis	Associate	39953608
Prion Diseases	Associate	35643629
Psychological Distress	Associate	39953608
Sarcoma	Associate	18620564, 35182012
Sarcoma Ewing	Associate	38492239
Stomach Neoplasms	Stimulate	37037864

TAF15 (TATA-box binding protein associated factor 15)