Gene Gene information from NCBI Gene database.
Entrez ID 8148
Gene name TATA-box binding protein associated factor 15
Gene symbol TAF15
Synonyms (NCBI Gene)
Npl3RBP56TAF2NTAFII68
Chromosome 17
Chromosome location 17q12
Summary This gene encodes a member of the TET family of RNA-binding proteins. The encoded protein plays a role in RNA polymerase II gene transcription as a component of a distinct subset of multi-subunit transcription initiation factor TFIID complexes. Translocat
miRNA miRNA information provided by mirtarbase database.
134
miRTarBase ID miRNA Experiments Reference
MIRT021732 hsa-miR-132-3p Microarray 17612493
MIRT025067 hsa-miR-181a-5p Microarray 17612493
MIRT030412 hsa-miR-24-3p Microarray 19748357
MIRT031463 hsa-miR-16-5p Proteomics 18668040
MIRT048160 hsa-miR-196a-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IEA
GO:0003712 Function Transcription coregulator activity IBA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601574 11547 ENSG00000270647
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q92804
Protein name TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56)
Protein function RNA and ssDNA-binding protein that may play specific roles during transcription initiation at distinct promoters. Binds to ssRNA containing the consensus sequence 5'-AGGUAA-3' (PubMed:21256132). Can enter the preinitiation complex together with
PDB 2MMY , 8ONS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 236 314 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00641 zf-RanBP 354 385 Zn-finger in Ran binding protein and others Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Observed in all fetal and adult tissues.
Sequence
MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQ
SGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQS
GYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGS
QGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQG
LGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAI
DWFDGKEFHGNIIK
VSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVC
PNPSCGNMNFARRNSCNQCNEPRPE
DSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGG
DRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYG
GDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSG
YGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY
Sequence length 592
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Basal transcription factors
Transcriptional misregulation in cancer
  RNA Polymerase II Pre-transcription Events
Regulation of TP53 Activity through Phosphorylation
RNA Polymerase II Promoter Escape
RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
RNA Polymerase II Transcription Initiation
RNA Polymerase II Transcription Initiation And Promoter Clearance
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
91
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs9894083 RCV005915181
Cholangiocarcinoma Benign rs9894083, rs4251785 RCV005915186
RCV005924617
Colon adenocarcinoma Likely benign rs201942273 RCV005933490
Colorectal cancer Benign rs4251785 RCV005924615
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
AA amyloidosis Associate 35643629
Adenocarcinoma of Lung Associate 36261009
Amyotrophic Lateral Sclerosis Associate 23755159, 26004182, 35643629, 37722062, 38492239
Bipolar Disorder Associate 28291257
Breast Neoplasms Associate 34908514, 36895010
Carcinogenesis Associate 22081015
Carcinoma Squamous Cell Associate 32871048
Cell Transformation Neoplastic Stimulate 31020999
Chondrosarcoma Associate 31020999
Chondrosarcoma Extraskeletal Myxoid Associate 24508382, 31020999, 36948401