|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q92804 |
| Protein name |
TATA-binding protein-associated factor 2N (68 kDa TATA-binding protein-associated factor) (TAF(II)68) (TAFII68) (RNA-binding protein 56) |
| Protein function |
RNA and ssDNA-binding protein that may play specific roles during transcription initiation at distinct promoters. Binds to ssRNA containing the consensus sequence 5'-AGGUAA-3' (PubMed:21256132). Can enter the preinitiation complex together with |
| PDB |
2MMY
, 8ONS
|
| Family and domains |
Pfam
| Accession |
ID |
Position in sequence |
Description |
Type |
| PF00076 |
RRM_1 |
236 → 314 |
RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) |
Domain |
| PF00641 |
zf-RanBP |
354 → 385 |
Zn-finger in Ran binding protein and others |
Domain |
|
| Tissue specificity |
TISSUE SPECIFICITY: Ubiquitous. Observed in all fetal and adult tissues. |
| Sequence |
MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQ SGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQS GYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGS QGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQG LGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAI DWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVC PNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGG DRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYG GDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSG YGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY
|
|
| Sequence length |
592 |
| Interactions |
View interactions |
| Phenotype Name |
Clinical Significance |
dbSNP ID |
RCV Accession |
| Acute myeloid leukemia |
Benign |
rs9894083 |
RCV005915181 |
| Cholangiocarcinoma |
Benign |
rs9894083, rs4251785 |
RCV005915186 RCV005924617 |
| Colon adenocarcinoma |
Likely benign |
rs201942273 |
RCV005933490 |
| Colorectal cancer |
Benign |
rs4251785 |
RCV005924615 |
| Gastric cancer |
Benign |
rs9894083 |
RCV005915183 |
| Hepatocellular carcinoma |
Benign |
rs9894083 |
RCV005915182 |
| Lung cancer |
Uncertain significance |
rs71381481 |
RCV005932759 |
| Malignant lymphoma, large B-cell, diffuse |
Benign |
rs4251785 |
RCV005924614 |
| Melanoma |
Uncertain significance |
rs774779964 |
RCV005930894 |
| Nonpapillary renal cell carcinoma |
Benign |
rs4251785 |
RCV005924612 |
| TAF15-related disorder |
Likely benign; Benign; Uncertain significance; Conflicting classifications of pathogenicity |
rs779360454, rs762946549, rs760281454, rs750774088, rs560923327, rs138790468, rs140268553, rs1321826060, rs745996982, rs4251786, rs4251785, rs150034643, rs768749438, rs777993379, rs1440860624, rs758278376, rs532683371, rs71381481, rs200175347, rs370345089, rs1568284800, rs767417430, rs144520577, rs373334865, rs2544170467, rs767068676, rs560641478, rs759467337, rs770927012, rs200841311, rs749994672, rs199888229, rs530070745, rs768963549, rs368498080, rs537726014, rs372970936, rs749600689, rs146792937, rs750957958, rs369399880, rs191538892, rs573414793, rs770334688, rs201942273, rs117677306, rs149293057, rs145295353, rs1301559653, rs144910879, rs138688016, rs779199064, rs114353269, rs140601071, rs144851351, rs773164507, rs4251755, rs145849645, rs139380403, rs140484493 View all (45 more) |
RCV003921216 RCV003956251 RCV003966194 RCV003910911 RCV004743554 RCV003956286 RCV003941049 RCV003948648 RCV003968411 RCV003931256 RCV003975802 RCV003975943 RCV003921345 RCV003941118 RCV003401674 RCV003948706 RCV003404139 RCV003410213 RCV003412046 RCV003412084 RCV003419245 RCV003410714 RCV003419254 RCV003414505 RCV003410645 RCV003414178 RCV003404407 RCV003402665 RCV003901050 RCV003896977 RCV003894558 RCV003923995 RCV003904603 RCV003899880 RCV003913873 RCV003939825 RCV003951883 RCV003951981 RCV003952144 RCV003947353 RCV003964136 RCV003951600 RCV003951735 RCV003949798 RCV003944509 RCV003949343 RCV003944752 RCV003942171 RCV003946764 RCV003946783 RCV003974750 RCV003967159 RCV003967179 RCV003948034 RCV004743232 RCV003916254 RCV003916255 RCV003918470 RCV003962913 RCV003905950 RCV003930789 RCV003940753 RCV003950649 RCV003910702 RCV003950630 RCV003923081 RCV003950779 RCV003970602 RCV003960465 |
| Thymoma |
Benign |
rs9894083 |
RCV005915185 |
| Uterine carcinosarcoma |
Benign |
rs9894083, rs4251785 |
RCV005915184 RCV005924616 |
| Uveal melanoma |
Benign |
rs4251785 |
RCV005924613 |
|
| Disease Name |
Relationship Type |
References |
| AA amyloidosis |
Associate |
35643629 |
| Adenocarcinoma of Lung |
Associate |
36261009 |
| Amyotrophic Lateral Sclerosis |
Associate |
23755159, 26004182, 35643629, 37722062, 38492239 |
| Bipolar Disorder |
Associate |
28291257 |
| Breast Neoplasms |
Associate |
34908514, 36895010 |
| Carcinogenesis |
Associate |
22081015 |
| Carcinoma Squamous Cell |
Associate |
32871048 |
| Cell Transformation Neoplastic |
Stimulate |
31020999 |
| Chondrosarcoma |
Associate |
31020999 |
| Chondrosarcoma Extraskeletal Myxoid |
Associate |
24508382, 31020999, 36948401 |
| Frontotemporal Lobar Degeneration |
Associate |
23049996, 30755280 |
| Heredodegenerative Disorders Nervous System |
Associate |
23049996 |
| Leukemia |
Associate |
18620564 |
| Leukemia T Cell |
Associate |
35182012 |
| Liver Neoplasms |
Associate |
30398641 |
| Malformations of Cortical Development Group I |
Associate |
28381165 |
| Motor Neuron Disease |
Associate |
22081015 |
| Nasopharyngeal Carcinoma |
Associate |
37257820 |
| Neoplasm Metastasis |
Associate |
23874428, 36261009, 36948401 |
| Neoplasms |
Associate |
18620564, 23049996, 24267890, 28945358, 31020999, 33674598 |
| Neoplasms |
Stimulate |
37037864 |
| Neurodegenerative Diseases |
Associate |
25375143, 35643629, 38492239 |
| Osteoporosis |
Associate |
39953608 |
| Prion Diseases |
Associate |
35643629 |
| Psychological Distress |
Associate |
39953608 |
| Sarcoma |
Associate |
18620564, 35182012 |
| Sarcoma Ewing |
Associate |
38492239 |
| Stomach Neoplasms |
Stimulate |
37037864 |
|