Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
814
Gene name Gene Name - the full gene name approved by the HGNC.
Calcium/calmodulin dependent protein kinase IV
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CAMK4
Synonyms (NCBI Gene) Gene synonyms aliases
CaMK IV, CaMK-GR, CaMKIV, caMK
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
The product of this gene belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This enzyme is a multifunctional serine/threonine protein kinase with limited tissue distribution, that has be
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1561515242 G>A Uncertain-significance, likely-pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024679 hsa-miR-215-5p Microarray 19074876
MIRT026869 hsa-miR-192-5p Microarray 19074876
MIRT030257 hsa-miR-26b-5p Microarray 19088304
MIRT437481 hsa-miR-185-5p Luciferase reporter assay, qRT-PCR, Western blot 24014023
MIRT719226 hsa-miR-5197-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001650 Component Fibrillar center IDA
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0002735 Process Positive regulation of myeloid dendritic cell cytokine production IMP 17909078
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
114080 1464 ENSG00000152495
Protein
UniProt ID Q16566
Protein name Calcium/calmodulin-dependent protein kinase type IV (CaMK IV) (EC 2.7.11.17) (CaM kinase-GR)
Protein function Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK4 signaling cascade and regulates, mainly by phosphorylation, the activity of several transcription activators, such as CREB1, MEF2D, JUN and RORA, whic
PDB 2W4O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 46 300 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, thymus, CD4 T-cells, testis and epithelial ovarian cancer tissue. {ECO:0000269|PubMed:12065094, ECO:0000269|PubMed:7961813, ECO:0000269|PubMed:8397199}.
Sequence
MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV

TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPS
PIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
Sequence length 473
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Calcium signaling pathway
cAMP signaling pathway
Longevity regulating pathway
Apelin signaling pathway
Osteoclast differentiation
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Oxytocin signaling pathway
Aldosterone synthesis and secretion
Amphetamine addiction
Alcoholism
Glioma
  CaMK IV-mediated phosphorylation of CREB
CREB1 phosphorylation through the activation of CaMKII/CaMKK/CaMKIV cascasde
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma, Asthma (childhood onset), Atopic asthma N/A N/A GWAS
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Hypothyroidism Hypothyroidism N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Autistic Disorder Associate 30262571
Coronary Disease Associate 35958279
COVID 19 Associate 34252574
Dystonia Associate 30262571
Heredodegenerative Disorders Nervous System Associate 30262571
Hypercalcemia Associate 18249060
Hyperkinesis Associate 30262571
Hypertension Associate 26909912
Intellectual Disability Associate 30262571
Leukemia Associate 25446257