Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8128
Gene name Gene Name - the full gene name approved by the HGNC.	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ST8SIA2
Synonyms (NCBI Gene) Gene synonyms aliases	HsT19690, SIAT8-B, SIAT8B, ST8SIA-II, ST8SiaII, STX
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q26.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. The encoded protein may be found in the Golgi apparatus and may be

Show/Hide all(97)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029111	hsa-miR-26b-5p	Microarray	19088304
MIRT1393961	hsa-miR-1207-5p	CLIP-seq
MIRT1393962	hsa-miR-1299	CLIP-seq
MIRT1393963	hsa-miR-149	CLIP-seq
MIRT1393964	hsa-miR-1908	CLIP-seq
MIRT1393965	hsa-miR-3064-5p	CLIP-seq
MIRT1393966	hsa-miR-3143	CLIP-seq
MIRT1393967	hsa-miR-3922-5p	CLIP-seq
MIRT1393968	hsa-miR-4274	CLIP-seq
MIRT1393969	hsa-miR-4505	CLIP-seq
MIRT1393970	hsa-miR-4533	CLIP-seq
MIRT1393971	hsa-miR-4747-5p	CLIP-seq
MIRT1393972	hsa-miR-4763-3p	CLIP-seq
MIRT1393973	hsa-miR-4782-5p	CLIP-seq
MIRT1393974	hsa-miR-4790-3p	CLIP-seq
MIRT1393975	hsa-miR-4794	CLIP-seq
MIRT1393976	hsa-miR-494	CLIP-seq
MIRT1393977	hsa-miR-514	CLIP-seq
MIRT1393978	hsa-miR-514b-3p	CLIP-seq
MIRT1393979	hsa-miR-516b	CLIP-seq
MIRT1393980	hsa-miR-518a-5p	CLIP-seq
MIRT1393981	hsa-miR-527	CLIP-seq
MIRT1393982	hsa-miR-543	CLIP-seq
MIRT1393983	hsa-miR-548a-5p	CLIP-seq
MIRT1393984	hsa-miR-548ab	CLIP-seq
MIRT1393985	hsa-miR-548ak	CLIP-seq
MIRT1393986	hsa-miR-548b-5p	CLIP-seq
MIRT1393987	hsa-miR-548c-5p	CLIP-seq
MIRT1393988	hsa-miR-548d-5p	CLIP-seq
MIRT1393989	hsa-miR-548h	CLIP-seq
MIRT1393990	hsa-miR-548i	CLIP-seq
MIRT1393991	hsa-miR-548j	CLIP-seq
MIRT1393992	hsa-miR-548w	CLIP-seq
MIRT1393993	hsa-miR-548y	CLIP-seq
MIRT1393994	hsa-miR-559	CLIP-seq
MIRT1393995	hsa-miR-604	CLIP-seq
MIRT1393996	hsa-miR-622	CLIP-seq
MIRT1393997	hsa-miR-642b	CLIP-seq
MIRT1393998	hsa-miR-647	CLIP-seq
MIRT1393999	hsa-miR-663	CLIP-seq
MIRT1394000	hsa-miR-802	CLIP-seq
MIRT1394001	hsa-miR-875-3p	CLIP-seq
MIRT2118264	hsa-miR-182	CLIP-seq
MIRT2118265	hsa-miR-31	CLIP-seq
MIRT2118266	hsa-miR-3135b	CLIP-seq
MIRT2118267	hsa-miR-4271	CLIP-seq
MIRT2118268	hsa-miR-4434	CLIP-seq
MIRT2118269	hsa-miR-4516	CLIP-seq
MIRT2118270	hsa-miR-4686	CLIP-seq
MIRT2118271	hsa-miR-4705	CLIP-seq
MIRT2118272	hsa-miR-4725-3p	CLIP-seq
MIRT1393971	hsa-miR-4747-5p	CLIP-seq
MIRT2118273	hsa-miR-498	CLIP-seq
MIRT2118274	hsa-miR-499a-5p	CLIP-seq
MIRT2118275	hsa-miR-625	CLIP-seq
MIRT1393961	hsa-miR-1207-5p	CLIP-seq
MIRT2340289	hsa-miR-122	CLIP-seq
MIRT1393964	hsa-miR-1908	CLIP-seq
MIRT2340290	hsa-miR-2116	CLIP-seq
MIRT2340291	hsa-miR-2467-3p	CLIP-seq
MIRT2340292	hsa-miR-28-5p	CLIP-seq
MIRT2340293	hsa-miR-296-3p	CLIP-seq
MIRT2340294	hsa-miR-3139	CLIP-seq
MIRT2340295	hsa-miR-331-3p	CLIP-seq
MIRT2340296	hsa-miR-342-5p	CLIP-seq
MIRT2340297	hsa-miR-3659	CLIP-seq
MIRT2340298	hsa-miR-3678-3p	CLIP-seq
MIRT2340299	hsa-miR-4255	CLIP-seq
MIRT2340300	hsa-miR-4302	CLIP-seq
MIRT2340301	hsa-miR-4450	CLIP-seq
MIRT2340302	hsa-miR-4456	CLIP-seq
MIRT1393969	hsa-miR-4505	CLIP-seq
MIRT2340303	hsa-miR-4508	CLIP-seq
MIRT2340304	hsa-miR-4664-5p	CLIP-seq
MIRT2340305	hsa-miR-4677-5p	CLIP-seq
MIRT2340306	hsa-miR-4697-3p	CLIP-seq
MIRT2340307	hsa-miR-4757-3p	CLIP-seq
MIRT1393972	hsa-miR-4763-3p	CLIP-seq
MIRT2340308	hsa-miR-486-3p	CLIP-seq
MIRT2340309	hsa-miR-491-5p	CLIP-seq
MIRT1393980	hsa-miR-518a-5p	CLIP-seq
MIRT1393981	hsa-miR-527	CLIP-seq
MIRT2340310	hsa-miR-541	CLIP-seq
MIRT2340311	hsa-miR-569	CLIP-seq
MIRT2340312	hsa-miR-578	CLIP-seq
MIRT2340313	hsa-miR-581	CLIP-seq
MIRT2340314	hsa-miR-582-3p	CLIP-seq
MIRT2340315	hsa-miR-654-5p	CLIP-seq
MIRT1393999	hsa-miR-663	CLIP-seq
MIRT2340316	hsa-miR-708	CLIP-seq
MIRT2395266	hsa-miR-125a-3p	CLIP-seq
MIRT2395267	hsa-miR-3202	CLIP-seq
MIRT2395268	hsa-miR-3934	CLIP-seq
MIRT2395269	hsa-miR-4265	CLIP-seq
MIRT2395270	hsa-miR-4296	CLIP-seq
MIRT2395271	hsa-miR-4322	CLIP-seq
MIRT2395272	hsa-miR-764	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0001574	Process	Ganglioside biosynthetic process	IDA	10766765
GO:0003828	Function	Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IBA	21873635
GO:0003828	Function	Alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IDA	10766765
GO:0005769	Component	Early endosome	IEA
GO:0005975	Process	Carbohydrate metabolic process	TAS	7559389
GO:0006464	Process	Cellular protein modification process	TAS	7559389
GO:0006486	Process	Protein glycosylation	IBA	21873635
GO:0006486	Process	Protein glycosylation	IDA	10766765
GO:0006486	Process	Protein glycosylation	IEA
GO:0006491	Process	N-glycan processing	IBA	21873635
GO:0006491	Process	N-glycan processing	IDA	10766765
GO:0007399	Process	Nervous system development	TAS	9054414
GO:0009311	Process	Oligosaccharide metabolic process	IBA	21873635
GO:0009311	Process	Oligosaccharide metabolic process	IDA	10766765
GO:0016021	Component	Integral component of membrane	IEA
GO:0033691	Function	Sialic acid binding	IC	10766765
GO:0055037	Component	Recycling endosome	IEA
GO:0097503	Process	Sialylation	IEA

MIM	HGNC	e!Ensembl
602546	10870	ENSG00000140557

Protein

UniProt ID

Q92186

Protein name

Alpha-2,8-sialyltransferase 8B (EC 2.4.3.-) (Sialyltransferase 8B) (SIAT8-B) (Sialyltransferase St8Sia II) (ST8SiaII) (Sialyltransferase X) (STX)

Protein function

Catalyzes the transfer of a sialic acid from a CMP-linked sialic acid donor onto a terminal alpha-2,3-, alpha-2,6-, or alpha-2,8-linked sialic acid of an N-linked glycan acceptor through alpha-2,8-linkages (Probable) (PubMed:10766765, PubMed:117

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00777	Glyco_transf_29	109 → 368	Glycosyltransferase family 29 (sialyltransferase)	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in fetal brain, kidney and heart and to a much lesser extent in adult heart and thymus. {ECO:0000269|PubMed:9054414}.

Sequence

MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVIN
GSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPG
DIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFGTCAIVGNSGVLLNSGCGQEIDAHSF
VIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHSLNGSILWI
PAFMARGGKERVEWVNELILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMY
TLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHE
QGALKLTVGQCDGAT

Sequence length

375

Interactions

View interactions

	Reactome
			Sialic acid metabolism NCAM1 interactions N-Glycan antennae elongation

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)	20663923
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	17126533, 22693595, 24070986, 24057454, 16969366

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.	GWAS, CBGDA
Aplastic anemia	Aplastic anemia		GWAS

Show/Hide Text Mining Associations (19)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Kidney Injury	Stimulate	19752028
Affective Disorders Psychotic	Associate	22693595
Autistic Disorder	Associate	20663923, 22693595, 24651862
Bipolar Disorder	Associate	22693595, 24651862, 26418860
Carcinoma Hepatocellular	Associate	24255131
Central Nervous System Diseases	Stimulate	19752028
Death	Associate	12454157
Diarrhea	Associate	12454157, 19752028
Esophageal Neoplasms	Associate	33357046
Hemolytic Uremic Syndrome	Associate	12454157
Meningioma	Associate	34943806
Mental Disorders	Associate	22693595
Neonatal Systemic lupus erythematosus	Associate	22886516
Neoplasms	Associate	23951351, 34544457, 34943806
Purpura Thrombotic Thrombocytopenic	Associate	12454157
Schizophrenia	Associate	22693595, 24651862, 26418860, 29353880, 30044798
Small Cell Lung Carcinoma	Associate	23951351
Soft Tissue Injuries	Associate	9657756
Vascular Diseases	Stimulate	9657756

ST8SIA2 (ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2)