DPF3 (double PHD fingers 3)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8110
Gene name Gene Name - the full gene name approved by the HGNC.
Double PHD fingers 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DPF3
Synonyms (NCBI Gene) Gene synonyms aliases
BAF45C, CERD4, SMARCG3
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the D4 protein family. The encoded protein is a transcription regulator that binds acetylated histones and is a component of the BAF chromatin remodeling complex. Alternate splicing results in multiple transcript variants enc
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(460)
miRTarBase ID miRNA Experiments Reference
MIRT030041 hsa-miR-26b-5p Microarray 19088304
MIRT616346 hsa-miR-3613-3p HITS-CLIP 23824327
MIRT617327 hsa-miR-5088-3p HITS-CLIP 23824327
MIRT616345 hsa-miR-6814-3p HITS-CLIP 23824327
MIRT616344 hsa-miR-6872-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(26)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin NAS 12192000
GO:0005515 Function Protein binding IPI 32459350
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
601672 17427 ENSG00000205683
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q92784
Protein name Zinc finger protein DPF3 (BRG1-associated factor 45C) (BAF45C) (Zinc finger protein cer-d4)
Protein function Belongs to the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to
PDB 2KWJ , 2KWK , 2KWN , 2KWO , 5I3L , 5SZB , 5SZC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14051 Requiem_N 13 → 84 N-terminal domain of DPF2/REQ. Family
PF00628 PHD 261 → 319 PHD-finger Domain
PF00628 PHD 318 → 366 PHD-finger Domain
Sequence 
MATVIHNPLKALGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCYIWMEKR
HRGPGLAPGQLYTYPARCWRKKRRLHPPEDPKLRLLEIKPEVELPLKKDGFTSESTTLEA
LLRGEGVEKKVDAREEESIQEIQRVLENDENVEEGNEEEDLEEDIPKRKNRTRGRARGSA
GGRRRHDAASQEDHDKPYVCDICGKRYKNRPGLSYHYAHTHLASEEGDEAQDQETRSPPN
HRNENHRPQKGPDGTVIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTL
NMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSC
HLCWELLKEKASAFGCQA
Sequence length 378
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  ATP-dependent chromatin remodeling
Thermogenesis
Hepatocellular carcinoma 		 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (5)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Gout Gout N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Renal Carcinoma Renal cell carcinoma N/A N/A GWAS
Show/Hide Text Mining Associations (18)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alcoholism Associate 28981154
Antisocial Personality Disorder Associate 28981154
Asthenozoospermia Associate 27232852
Azoospermia Associate 28975488
Carcinoma Renal Cell Associate 34390653, 35148991, 35945219
Cleft Lip Associate 18978678
Congenital Abnormalities Associate 18978678
Enterocolitis Necrotizing Associate 28378556
Head and Neck Neoplasms Associate 24271036
Hypoxia Associate 35148991