COLEC12 (collectin subfamily member 12)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
81035
Gene name Gene Name - the full gene name approved by the HGNC.
Collectin subfamily member 12
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
COLEC12
Synonyms (NCBI Gene) Gene synonyms aliases
CLP1, NSR2, SCARA4, SRCL
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18p11.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. This protein is a scavenger receptor that displays several functions associated with host defense. It can bind to carboh
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(259)
miRTarBase ID miRNA Experiments Reference
MIRT021483 hsa-miR-9-5p Sequencing 20371350
MIRT025879 hsa-miR-7-5p Sequencing 20371350
MIRT029943 hsa-miR-26b-5p Microarray 19088304
MIRT615075 hsa-miR-520f-3p HITS-CLIP 23824327
MIRT615074 hsa-miR-302c-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(26)
GO ID Ontology Definition Evidence Reference
GO:0002682 Process Regulation of immune system process IEA
GO:0005044 Function Scavenger receptor activity IDA 11564734
GO:0005044 Function Scavenger receptor activity TAS 11162630
GO:0005515 Function Protein binding IPI 22396535, 26922829, 33961781
GO:0005534 Function Galactose binding NAS 11564734
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
607621 16016 ENSG00000158270
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q5KU26
Protein name Collectin-12 (Collectin placenta protein 1) (CL-P1) (hCL-P1) (Nurse cell scavenger receptor 2) (Scavenger receptor class A member 4) (Scavenger receptor with C-type lectin)
Protein function Scavenger receptor that displays several functions associated with host defense. Promotes binding and phagocytosis of Gram-positive, Gram-negative bacteria and yeast. Mediates the recognition, internalization and degradation of oxidatively modif
PDB 2OX8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01391 Collagen 441 → 499 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 530 → 589 Collagen triple helix repeat (20 copies) Repeat
PF00059 Lectin_C 624 → 732 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in perivascular macrophages. Expressed in plaques-surrounding reactive astrocytes and in perivascular astrocytes associated with cerebral amyloid angiopathy (CAA) in the temporal cortex of Alzheimer patient (at protein level)
Sequence 
MKDDFAEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCALLTITVAILGYK
VVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQ
QLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTN
LQQDTSVLQGNLQNQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKND
FQNLQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANNDTLEDMNSQLNSFTGQMENI
TTISQANEQNLKDLQDLHKDAENRTAIKFNQLEERFQLFETDIVNIISNISYTAHHLRTL
TSNLNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLRMQQDLMRSRLDTEVANLSVI
MEEMKLVDSKHGQLIKNFTILQGPPGPRGPRGDRGSQGPPGPTGNKGQKGEKGEPGPPGP
AGERGPIGPAGPPGERGGKGSKGSQGPKGSRGSPGKPGPQGSSGDPGPPGPPGKEGLPGP
QGPPGFQGLQGTVGEPGVPGPRGLPGLPGVPGMPGPKGPPGPPGPSGAVVPLALQNEPTP
APEDNGCPPHWKNFTDKCYYFSVEKEIFEDAKLFCEDKSSHLVFINTREEQQWIKKQMVG
RESHWIGLTDSERENEWKWLDGTSPDYKNWKAGQPDNWGHGHGPGEDCAGLIYAGQWNDF
QCEDVNNFICEKDRETVLSSAL
Sequence length 742
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Phagosome   Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Scavenging by Class A Receptors
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coenzyme Q10 Deficiency Coenzyme Q10 levels N/A N/A GWAS
Dementia Dementia N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Show/Hide Text Mining Associations (14)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Amyotrophic Lateral Sclerosis Associate 40033250
Ataxia Telangiectasia Associate 25887408
Breast Neoplasms Associate 36131924
Colorectal Neoplasms Associate 37144239
Diabetes Mellitus Type 2 Inhibit 36131924
Ehlers Danlos syndrome type 3 Associate 27518164
Glomerulonephritis Associate 37020564
Glomerulonephritis IGA Associate 37020564
Inflammation Associate 27518164
Medulloblastoma Associate 37083768