Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	810
Gene name Gene Name - the full gene name approved by the HGNC.	Calmodulin like 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CALML3
Synonyms (NCBI Gene) Gene synonyms aliases	CLP
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10p15.1

Show/Hide all(106)

miRTarBase ID	miRNA	Experiments	Reference
MIRT489727	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT489725	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT489726	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT489724	hsa-miR-940	PAR-CLIP	23592263
MIRT489723	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT489722	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT489721	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT489720	hsa-miR-6087	PAR-CLIP	23592263
MIRT489719	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT489718	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT489717	hsa-miR-765	PAR-CLIP	23592263
MIRT489716	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT489715	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT489714	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT489713	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT489712	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT489710	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT489711	hsa-miR-5698	PAR-CLIP	23592263
MIRT489709	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT489708	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT489707	hsa-miR-4525	PAR-CLIP	23592263
MIRT489706	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT489705	hsa-miR-1275	PAR-CLIP	23592263
MIRT489704	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT489727	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT489725	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT489726	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT489724	hsa-miR-940	PAR-CLIP	23592263
MIRT489723	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT489722	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT489721	hsa-miR-6798-5p	PAR-CLIP	23592263
MIRT489720	hsa-miR-6087	PAR-CLIP	23592263
MIRT489719	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT489718	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT489717	hsa-miR-765	PAR-CLIP	23592263
MIRT489716	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT489715	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT489714	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT489713	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT489712	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT489710	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT489711	hsa-miR-5698	PAR-CLIP	23592263
MIRT489709	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT489708	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT489707	hsa-miR-4525	PAR-CLIP	23592263
MIRT489706	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT489705	hsa-miR-1275	PAR-CLIP	23592263
MIRT489704	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT859531	hsa-miR-1253	CLIP-seq
MIRT859532	hsa-miR-139-3p	CLIP-seq
MIRT859533	hsa-miR-145	CLIP-seq
MIRT859534	hsa-miR-2115	CLIP-seq
MIRT859535	hsa-miR-2467-3p	CLIP-seq
MIRT859536	hsa-miR-3665	CLIP-seq
MIRT859537	hsa-miR-3678-3p	CLIP-seq
MIRT859538	hsa-miR-3919	CLIP-seq
MIRT859539	hsa-miR-4300	CLIP-seq
MIRT859540	hsa-miR-4419a	CLIP-seq
MIRT859541	hsa-miR-4433	CLIP-seq
MIRT859542	hsa-miR-4510	CLIP-seq
MIRT859543	hsa-miR-455-3p	CLIP-seq
MIRT859544	hsa-miR-4722-5p	CLIP-seq
MIRT859545	hsa-miR-4734	CLIP-seq
MIRT859546	hsa-miR-4747-5p	CLIP-seq
MIRT859547	hsa-miR-493	CLIP-seq
MIRT859548	hsa-miR-596	CLIP-seq
MIRT859549	hsa-miR-625	CLIP-seq
MIRT859550	hsa-miR-665	CLIP-seq
MIRT859551	hsa-miR-920	CLIP-seq
MIRT859533	hsa-miR-145	CLIP-seq
MIRT859534	hsa-miR-2115	CLIP-seq
MIRT859539	hsa-miR-4300	CLIP-seq
MIRT859540	hsa-miR-4419a	CLIP-seq
MIRT859542	hsa-miR-4510	CLIP-seq
MIRT859543	hsa-miR-455-3p	CLIP-seq
MIRT859548	hsa-miR-596	CLIP-seq
MIRT859550	hsa-miR-665	CLIP-seq
MIRT859551	hsa-miR-920	CLIP-seq
MIRT859533	hsa-miR-145	CLIP-seq
MIRT859534	hsa-miR-2115	CLIP-seq
MIRT859539	hsa-miR-4300	CLIP-seq
MIRT859540	hsa-miR-4419a	CLIP-seq
MIRT859542	hsa-miR-4510	CLIP-seq
MIRT859543	hsa-miR-455-3p	CLIP-seq
MIRT859548	hsa-miR-596	CLIP-seq
MIRT859550	hsa-miR-665	CLIP-seq
MIRT859551	hsa-miR-920	CLIP-seq
MIRT859533	hsa-miR-145	CLIP-seq
MIRT859534	hsa-miR-2115	CLIP-seq
MIRT859539	hsa-miR-4300	CLIP-seq
MIRT859540	hsa-miR-4419a	CLIP-seq
MIRT859542	hsa-miR-4510	CLIP-seq
MIRT859543	hsa-miR-455-3p	CLIP-seq
MIRT859548	hsa-miR-596	CLIP-seq
MIRT859550	hsa-miR-665	CLIP-seq
MIRT859551	hsa-miR-920	CLIP-seq
MIRT2446095	hsa-miR-1827	CLIP-seq
MIRT2446096	hsa-miR-1909	CLIP-seq
MIRT2446097	hsa-miR-3612	CLIP-seq
MIRT859549	hsa-miR-625	CLIP-seq
MIRT2446098	hsa-miR-650	CLIP-seq
MIRT2446095	hsa-miR-1827	CLIP-seq
MIRT2446096	hsa-miR-1909	CLIP-seq
MIRT2446097	hsa-miR-3612	CLIP-seq
MIRT859549	hsa-miR-625	CLIP-seq
MIRT2446098	hsa-miR-650	CLIP-seq

Show/Hide all(5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	16189514, 18570893, 21044950, 25416956, 32296183
GO:0030234	Function	Enzyme regulator activity	IBA	21873635
GO:0050790	Process	Regulation of catalytic activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867

MIM	HGNC	e!Ensembl
114184	1452	ENSG00000178363

Protein

UniProt ID

P27482

Protein name

Calmodulin-like protein 3 (CaM-like protein) (CLP) (Calmodulin-related protein NB-1)

Protein function

May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different aff

PDB

1GGZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00036	EF-hand_1	12 → 40	EF hand	Domain
PF00036	EF-hand_1	48 → 76	EF hand	Domain
PF00036	EF-hand_1	85 → 113	EF hand	Domain
PF00036	EF-hand_1	121 → 149	EF hand	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells. {ECO:0000269|PubMed:2217169}.

Sequence

MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDG
NGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDE
EVDEMIRAADTDGDGQVNYEEFVRVLVSK

Sequence length

149

Interactions

View interactions

	KEGG
	Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway cGMP-PKG signaling pathway cAMP signaling pathway Phosphatidylinositol signaling system Oocyte meiosis Cellular senescence Adrenergic signaling in cardiomyocytes Vascular smooth muscle contraction Apelin signaling pathway C-type lectin receptor signaling pathway Circadian entrainment Long-term potentiation Neurotrophin signaling pathway Dopaminergic synapse Olfactory transduction Phototransduction Inflammatory mediator regulation of TRP channels Insulin signaling pathway GnRH signaling pathway Estrogen signaling pathway Melanogenesis Oxytocin signaling pathway Glucagon signaling pathway Renin secretion Aldosterone synthesis and secretion Salivary secretion Gastric acid secretion Alzheimer disease Parkinson disease Pathways of neurodegeneration - multiple diseases Amphetamine addiction Alcoholism Pertussis Tuberculosis Human cytomegalovirus infection Kaposi sarcoma-associated herpesvirus infection Human immunodeficiency virus 1 infection Pathways in cancer Glioma Lipid and atherosclerosis Fluid shear stress and atherosclerosis

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	27935865

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Inhibit	23638045
Carcinoma Hepatocellular	Associate	32280695
Carcinoma Squamous Cell	Associate	37442189
Endometrial Neoplasms	Associate	36807337
Neoplasm Metastasis	Associate	31298313
Neoplasms	Inhibit	11278607, 7528142
Neoplasms	Associate	23638045, 31298313
Skin Diseases	Associate	23638045
Thyroid Cancer Papillary	Associate	35351042
Urinary Bladder Neoplasms	Associate	31298313
Uterine Cervical Neoplasms	Associate	31298313

CALML3 (calmodulin like 3)