Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8089
Gene name Gene Name - the full gene name approved by the HGNC.
YEATS domain containing 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
YEATS4
Synonyms (NCBI Gene) Gene synonyms aliases
4930573H17Rik, B230215M10Rik, GAS41, NUBI-1, YAF9
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q15
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein migh
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT564439 hsa-miR-8084 PAR-CLIP 20371350
MIRT564438 hsa-miR-200b-3p PAR-CLIP 20371350
MIRT564437 hsa-miR-200c-3p PAR-CLIP 20371350
MIRT564436 hsa-miR-429 PAR-CLIP 20371350
MIRT564435 hsa-miR-214-5p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000278 Process Mitotic cell cycle NAS 10913114
GO:0005200 Function Structural constituent of cytoskeleton NAS 10913114
GO:0005515 Function Protein binding IPI 11903063, 32296183
GO:0005634 Component Nucleus IDA 18445686
GO:0005654 Component Nucleoplasm IDA 10913114
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602116 24859 ENSG00000127337
Protein
UniProt ID O95619
Protein name YEATS domain-containing protein 4 (Glioma-amplified sequence 41) (Gas41) (NuMA-binding protein 1) (NuBI-1) (NuBI1)
Protein function Chromatin reader component of the NuA4 histone acetyltransferase (HAT) complex, a complex involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A (PubMed:12963728, PubMed:14966270). Sp
PDB 5R68 , 5R69 , 5VNA , 5VNB , 5XTZ , 5Y8V , 7EIF , 7JFY , 8DKB , 8I60 , 8IIY , 8IIZ , 8IJ0 , 8X15 , 8X19 , 8X1C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03366 YEATS 44 124 YEATS family Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle. {ECO:0000269|PubMed:10913114}.
Sequence
MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMS
AYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKL
FQSD
TNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTR
EKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI
Sequence length 227
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  ATP-dependent chromatin remodeling   Activation of the TFAP2 (AP-2) family of transcription factors
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Carcinogenesis Associate 26307679, 39788387
Carcinoma Non Small Cell Lung Associate 29437725, 34289376
Glioblastoma Associate 11756182, 22619067, 27467502
Glioma Associate 21317290, 22619067, 39788387
Heart Failure Associate 37092838
Liposarcoma Associate 20601955
Lung Neoplasms Associate 29437725, 34289376
Neoplasm Metastasis Associate 26307679, 39788387
Neoplasms Associate 27255164, 27467502, 29437725, 34289376, 39788387
Ovarian Neoplasms Associate 26307679