Gene Gene information from NCBI Gene database.
Entrez ID 8089
Gene name YEATS domain containing 4
Gene symbol YEATS4
Synonyms (NCBI Gene)
4930573H17RikB230215M10RikGAS41NUBI-1YAF9
Chromosome 12
Chromosome location 12q15
Summary The protein encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein migh
miRNA miRNA information provided by mirtarbase database.
142
miRTarBase ID miRNA Experiments Reference
MIRT564439 hsa-miR-8084 PAR-CLIP 20371350
MIRT564438 hsa-miR-200b-3p PAR-CLIP 20371350
MIRT564437 hsa-miR-200c-3p PAR-CLIP 20371350
MIRT564436 hsa-miR-429 PAR-CLIP 20371350
MIRT564435 hsa-miR-214-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30
GO ID Ontology Definition Evidence Reference
GO:0000278 Process Mitotic cell cycle NAS 10913114
GO:0000786 Component Nucleosome IDA 27153538
GO:0000786 Component Nucleosome NAS 16634648
GO:0005200 Function Structural constituent of cytoskeleton NAS 10913114
GO:0005515 Function Protein binding IPI 10913114, 11903063, 32296183, 32707033
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602116 24859 ENSG00000127337
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95619
Protein name YEATS domain-containing protein 4 (Glioma-amplified sequence 41) (Gas41) (NuMA-binding protein 1) (NuBI-1) (NuBI1)
Protein function Chromatin reader component of the NuA4 histone acetyltransferase (HAT) complex, a complex involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A (PubMed:12963728, PubMed:14966270). Sp
PDB 5R68 , 5R69 , 5VNA , 5VNB , 5XTZ , 5Y8V , 7EIF , 7JFY , 8DKB , 8I60 , 8IIY , 8IIZ , 8IJ0 , 8X15 , 8X19 , 8X1C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03366 YEATS 44 124 YEATS family Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle. {ECO:0000269|PubMed:10913114}.
Sequence
MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMS
AYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKL
FQSD
TNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTR
EKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI
Sequence length 227
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  ATP-dependent chromatin remodeling   Activation of the TFAP2 (AP-2) family of transcription factors