EGFL8 (EGF like domain multiple 8)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80864
Gene name Gene Name - the full gene name approved by the HGNC.
EGF like domain multiple 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EGFL8
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf8, NG3
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.32
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(5)
miRTarBase ID miRNA Experiments Reference
MIRT954722 hsa-miR-4455 CLIP-seq
MIRT954723 hsa-miR-4650-5p CLIP-seq
MIRT954724 hsa-miR-4659a-3p CLIP-seq
MIRT954725 hsa-miR-4659b-3p CLIP-seq
MIRT954726 hsa-miR-609 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0001701 Process In utero embryonic development ISS
GO:0005102 Function Signaling receptor binding IBA 21873635
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 32814053
GO:0005576 Component Extracellular region IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609897 13944 ENSG00000241404
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q99944
Protein name Epidermal growth factor-like protein 8 (EGF-like protein 8) (Vascular endothelial statin-2) (VE-statin-2)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07546 EMI 35 → 102 EMI domain Domain
PF00008 EGF 114 → 140 EGF-like domain Domain
PF07645 EGF_CA 144 → 183 Calcium-binding EGF domain Domain
Sequence 
MGSRAELCTLLGGFSFLLLLIPGEGAKGGSLRESQGVCSKQTLVVPLHYNESYSQPVYKP
YLTLCAGRRICSTYRTMYRVMWREVRREVQQTHAVCCQGWKKRHPGALTCEAICAKPCLN
GGVCVRPDQCECAPGWGGKHCHVDVDECRTSITLCSHHCFNTAGSFTCGCPHDLVLGVDG
RTCMEGSPEPPTSASILSVAVREAEKDERALKQEIHELRGRLERLEQWAGQAGAWVRAVL
PVPPEELQPEQVAELWGRGDRIESLSDQVLLLEERLGACSCEDNSLGLGVNHR
Sequence length 293
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Rheumatoid arthritis Rheumatoid Arthritis rs587776843 17804836, 21156761, 19503088
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Sarcoidosis Sarcoidosis GWAS
Psoriasis Psoriasis GWAS
Show/Hide Text Mining Associations (5)
Associations from Text Mining
Disease Name Relationship Type References
Leukoencephalopathies Associate 34626176
Mevalonate Kinase Deficiency Associate 29268706
Neoplasms Associate 33712610
Neoplasms Inhibit 39796130
Ovarian Neoplasms Inhibit 39796130