EGFL8 (EGF like domain multiple 8)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 80864
Gene name EGF like domain multiple 8
Gene symbol EGFL8
Synonyms (NCBI Gene)
C6orf8NG3
Chromosome 6
Chromosome location 6p21.32
miRNA miRNA information provided by mirtarbase database.
5
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (5)
miRTarBase ID miRNA Experiments Reference
MIRT954722 hsa-miR-4455 CLIP-seq
MIRT954723 hsa-miR-4650-5p CLIP-seq
MIRT954724 hsa-miR-4659a-3p CLIP-seq
MIRT954725 hsa-miR-4659b-3p CLIP-seq
MIRT954726 hsa-miR-609 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (8)
GO ID Ontology Definition Evidence Reference
GO:0001570 Process Vasculogenesis IBA
GO:0001701 Process In utero embryonic development ISS
GO:0005102 Function Signaling receptor binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 32814053
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
609897 13944 ENSG00000241404
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99944
Protein name Epidermal growth factor-like protein 8 (EGF-like protein 8) (Vascular endothelial statin-2) (VE-statin-2)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07546 EMI 35 → 102 EMI domain Domain
PF00008 EGF 114 → 140 EGF-like domain Domain
PF07645 EGF_CA 144 → 183 Calcium-binding EGF domain Domain
Sequence 
MGSRAELCTLLGGFSFLLLLIPGEGAKGGSLRESQGVCSKQTLVVPLHYNESYSQPVYKP
YLTLCAGRRICSTYRTMYRVMWREVRREVQQTHAVCCQGWKKRHPGALTCEAICAKPCLN
GGVCVRPDQCECAPGWGGKHCHVDVDECRTSITLCSHHCFNTAGSFTCGCPHDLVLGVDG
RTCMEGSPEPPTSASILSVAVREAEKDERALKQEIHELRGRLERLEQWAGQAGAWVRAVL
PVPPEELQPEQVAELWGRGDRIESLSDQVLLLEERLGACSCEDNSLGLGVNHR
Sequence length 293
Interactions View interactions