Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80863
Gene name Gene Name - the full gene name approved by the HGNC.
Proline rich transmembrane protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRRT1
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf31, DSPD1, IFITMD7, NG5, SynDIG4
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.32
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1268180 hsa-miR-1250 CLIP-seq
MIRT1268181 hsa-miR-1253 CLIP-seq
MIRT1268182 hsa-miR-1293 CLIP-seq
MIRT1268183 hsa-miR-1908 CLIP-seq
MIRT1268184 hsa-miR-2682 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0006468 Process Protein phosphorylation ISS
GO:0007611 Process Learning or memory IEA
GO:0016020 Component Membrane IBA 21873635
GO:0030545 Function Receptor regulator activity IEA
GO:0030672 Component Synaptic vesicle membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
618297 13943 ENSG00000204314
Protein
UniProt ID Q99946
Protein name Proline-rich transmembrane protein 1 (Dispanin subfamily D member 1) (DSPD1) (Synapse differentiation-induced protein 4) (SynDIG4)
Protein function Required to maintain a pool of extrasynaptic AMPA-regulated glutamate receptors (AMPAR) which is necessary for synapse development and function. Regulates basal AMPAR function and synaptic transmission during development but is dispensable at ma
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04505 CD225 219 286 Interferon-induced transmembrane protein Family
Sequence
MSSEKSGLPDSVPHTSPPPYNAPQPPAEPPAPPPQAAPSSHHHHHHHYHQSGTATLPRLG
AGGLASSAATAQRGPSSSATLPRPPHHAPPGPAAGAPPPGCATLPRMPPDPYLQETRFEG
PLPPPPPAAAAPPPPAPAQTAQAPGFVVPTHAGTVGTLPLGGYVAPGYPLQLQPCTAYVP
VYPVGTPYAGGTPGGTGVTSTLPPPPQGPGLALLEPRRPPHDYMPIAVLTTICCFWPTGI
IAIFKAVQVRTALARGDMVSAEIASREARNFSFISLAVGIAAMVLC
TILTVVIIIAAQHH
ENYWDP
Sequence length 306
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Diabetes mellitus Diabetes Mellitus, Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
17632545
Rheumatoid arthritis Rheumatoid Arthritis rs587776843 21156761
Unknown
Disease term Disease name Evidence References Source
Systemic lupus erythematosus Systemic lupus erythematosus GWAS
Diabetes Diabetes GWAS
Psoriasis Psoriasis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 39773540
Breast Neoplasms Associate 25774687
Cardiomyopathy Hypertrophic Associate 36499607
Mevalonate Kinase Deficiency Associate 29268706
Ovarian Diseases Associate 19849863
Seizures Associate 27251580