Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80856
Gene name Gene Name - the full gene name approved by the HGNC.
Lunapark, ER junction formation factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LNPK
Synonyms (NCBI Gene) Gene synonyms aliases
KIAA1715, LNP, LNP1, NEDEHCC, Ul, ulnaless
Disease Acronyms (UniProt) Disease acronyms from UniProt database
NEDEHCC
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.1
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1391644554 G>A Pathogenic Stop gained, non coding transcript variant, coding sequence variant
rs1553498948 T>- Pathogenic Non coding transcript variant, frameshift variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT675550 hsa-miR-548ae-3p HITS-CLIP 23824327
MIRT675549 hsa-miR-548ah-3p HITS-CLIP 23824327
MIRT675548 hsa-miR-548aj-3p HITS-CLIP 23824327
MIRT675547 hsa-miR-548am-3p HITS-CLIP 23824327
MIRT675546 hsa-miR-548aq-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005654 Component Nucleoplasm IDA
GO:0005783 Component Endoplasmic reticulum IDA
GO:0005789 Component Endoplasmic reticulum membrane IDA 24223779
GO:0007029 Process Endoplasmic reticulum organization IMP 30032983
GO:0007596 Process Blood coagulation IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610236 21610 ENSG00000144320
Protein
UniProt ID Q9C0E8
Protein name Endoplasmic reticulum junction formation protein lunapark (ER junction formation factor lunapark)
Protein function Endoplasmic reticulum (ER)-shaping membrane protein that plays a role in determining ER morphology (PubMed:30032983). Involved in the stabilization of nascent three-way ER tubular junctions within the ER network (PubMed:24223779, PubMed:25404289
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10058 zinc_ribbon_10 255 305 Predicted integral membrane zinc-ribbon metal-binding protein Family
Tissue specificity TISSUE SPECIFICITY: Expressed in neural precursor cells, where it is detected at the growth-cone-like structure and branching sites of neurite-like processes. {ECO:0000269|PubMed:30032983}.
Sequence
MGGLFSRWRTKPSTVEVLESIDKEIQALEEFREKNQRLQKLWVGRLILYSSVLYLFTCLI
VYLWYLPDEFTARLAMTLPFFAFPLIIWSIRTVIIFFFSKRTERNNEALDDLKSQRKKIL
EEVMEKETYKTAKLILERFDPDSKKAKECEPPSAGAAVTARPGQEIRQRTAAQRNLSPTP
ASPNQGPPPQVPVSPGPPKDSSAPGGPPERTVTPALSSNVLPRHLGSPATSVPGMGLHPP
GPPLARPILPRERGALDRIVEYLVGDGPQNRYALICQQCFSHNGMALKEEFEYIAFRCAY
CFFLN
PARKTRPQAPRLPEFSFEKRQVVEGSSSVGPLPSGSVLSSDNQFNEESLEHDVLD
DNTEQTDDKIPATEQTNQVIEKASDSEEPEEKQETENEEASVIETNSTVPGADSIPDPEL
SGESLTAE
Sequence length 428
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
30032983
Mental retardation Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
30032983
Neurodevelopmental disorder with epilepsy and hypoplasia of the corpus callosum NEURODEVELOPMENTAL DISORDER WITH EPILEPSY AND HYPOPLASIA OF THE CORPUS CALLOSUM rs1553498948, rs1391644554 30032983
Unknown
Disease term Disease name Evidence References Source
Pelvic Organ Prolapse Pelvic Organ Prolapse GWAS
Neuroticism Neuroticism GWAS
Carpal Tunnel Syndrome Carpal Tunnel Syndrome GWAS
Schizophrenia Schizophrenia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Hepatic Veno Occlusive Disease Associate 31790828
Neoplasm Metastasis Inhibit 37087570
Neoplasms Associate 37087570
Periodontitis Associate 35179257