Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80829
Gene name Gene Name - the full gene name approved by the HGNC.
ZFP91 zinc finger protein, atypical E3 ubiquitin ligase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZFP91
Synonyms (NCBI Gene) Gene synonyms aliases
DMS-8, DSM-8, DSM8, FKSG11, PZF, ZFP-91, ZNF757
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q12.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the zinc finger family of proteins. The gene product contains C2H2-type domains, which are the classical zinc finger domains found in numerous nucleic acid-binding proteins. This protein functions as a regul
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019693 hsa-miR-375 Microarray 20215506
MIRT027985 hsa-miR-93-5p Sequencing 20371350
MIRT049964 hsa-miR-29a-3p CLASH 23622248
MIRT181494 hsa-miR-595 HITS-CLIP 23313552
MIRT697421 hsa-miR-28-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004842 Function Ubiquitin-protein transferase activity IDA 20682767
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
619289 14983 ENSG00000186660
Protein
UniProt ID Q96JP5
Protein name E3 ubiquitin-protein ligase ZFP91 (EC 2.3.2.27) (RING-type E3 ubiquitin transferase ZFP91) (Zinc finger protein 757) (Zinc finger protein 91 homolog) (Zfp-91)
Protein function Atypical E3 ubiquitin-protein ligase that mediates 'Lys-63'-linked ubiquitination of MAP3K14/NIK, leading to stabilize and activate MAP3K14/NIK. It thereby acts as an activator of the non-canonical NF-kappa-B2/NFKB2 pathway. May also play an imp
PDB 2M9A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 372 394 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 400 422 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 430 453 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed ubiquitously, particularly at high level in testis. Isoform 2 is testis specific.
Sequence
MPGETEEPRPPEQQDQEGGEAAKAAPEEPQQRPPEAVAAAPAGTTSSRVLRGGRDRGRAA
AAAAAAAVSRRRKAEYPRRRRSSPSARPPDVPGQQPQAAKSPSPVQGKKSPRLLCIEKVT
TDKDPKEEKEEEDDSALPQEVSIAASRPSRGWRSSRTSVSRHRDTENTRSSRSKTGSLQL
ICKSEPNTDQLDYDVGEEHQSPGGISSEEEEEEEEEMLISEEEIPFKDDPRDETYKPHLE
RETPKPRRKSGKVKEEKEKKEIKVEVEVEVKEEENEIREDEEPPRKRGRRRKDDKSPRLP
KRRKKPPIQYVRCEMEGCGTVLAHPRYLQHHIKYQHLLKKKYVCPHPSCGRLFRLQKQLL
RHAKHHTDQRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMK
KH
DADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEVLIAEALAANAGALITSTDILGTNP
ESLTQPSDGQGLPLLPEPLGNSTSGECLLLEAEGMSKSYCSGTERVSLMADGKIFVGSGS
SGGTEGLVMNSDILGATTEVLIEDSDSAGP
Sequence length 570
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Hypertension Hypertension (confirmatory factor analysis Factor 12), High blood pressure / hypertension N/A N/A GWAS
Lymphoma Lymphoma N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Leukemia Myeloid Acute Stimulate 24272675
Leukemia Myeloid Acute Associate 35165513
Lymphoma T Cell Associate 34936696
Prostatic Diseases Associate 24272675
Prostatic Hyperplasia Stimulate 24272675
Prostatic Neoplasms Associate 24272675
Prostatic Neoplasms Stimulate 27975057
Psoriasis Associate 35371093
Stomach Neoplasms Associate 29471891
Tuberculosis Osteoarticular Associate 35371093