Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80790
Gene name Gene Name - the full gene name approved by the HGNC.
C-Maf inducing protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CMIP
Synonyms (NCBI Gene) Gene synonyms aliases
TCMIP
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q23.2-q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a c-Maf inducing protein that plays a role in T-cell signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT028209 hsa-miR-33a-5p Sequencing 20371350
MIRT558688 hsa-miR-3121-3p PAR-CLIP 21572407
MIRT558687 hsa-miR-3529-3p PAR-CLIP 21572407
MIRT195826 hsa-miR-302a-5p PAR-CLIP 21572407
MIRT558686 hsa-miR-200c-5p PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001701 Process In utero embryonic development IEA
GO:0005515 Function Protein binding IPI 20018188
GO:0005654 Component Nucleoplasm IBA 21873635
GO:0005654 Component Nucleoplasm IDA
GO:0005829 Component Cytosol IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610112 24319 ENSG00000153815
Protein
UniProt ID Q8IY22
Protein name C-Maf-inducing protein (c-Mip) (Truncated c-Maf-inducing protein) (Tc-Mip)
Protein function Plays a role in T-cell signaling pathway. Isoform 2 may play a role in T-helper 2 (Th2) signaling pathway and seems to represent the first proximal signaling protein that links T-cell receptor-mediated signal to the activation of c-Maf Th2 speci
Family and domains
Tissue specificity TISSUE SPECIFICITY: Isoform 1 is expressed in peripheral blood mononuclear cells and kidney. Lower expression in brain and liver. Expression is down-regulated in activated cells. Isoform 2 is expressed in lymphocyte precursors, however, expression shuts d
Sequence
MDVTSSSGGGGDPRQIEETKPLLGGDVSAPEGTKMGAVPCRRALLLCNGMRYKLLQEGDI
QVCVIRHPRTFLSKILTSKFLRRWEPHHLTLADNSLASATPTGYMENSVSYSAIEDVQLL
SWENAPKYCLQLTIPGGTVLLQAANSYLRDQWFHSLQWKKKIYKYKKVLSNPSRWEVVLK
EIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQEHENIIVAIAPLLENNHPPP
DLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHNMDFGKCPRLRLFTQEYILALNELNAG
MEVVKKFIQSMHGPTGHCPHPRVLPNLVAVCLAAIYSCYEEFINSRDNSPSLKEIRNGCQ
QPCDRKPTLPLRLLHPSPDLVSQEATLSEARLKSVVVASSEIHVEVERTSTAKPALTASA
GNDSEPNLIDCLMVSPACSTMSIELGPQADRTLGCYVEILKLLSDYDDWRPSLASLLQPI
PFPKEALAHEKFTKELKYVIQRFAEDPRQEVHSCLLSVRAGKDGWFQLYSPGGVACDDDG
ELFASMVHILMGSCYKTKKFLLSLAENKLGPCMLLALRGNQTMVEILCLMLEYNIIDNND
TQLQIISTLESTDVGKRMYEQLCDRQRELKELQRKGGPTRLTLPSKSTDADLARLLSSGS
FGNLENLSLAFTNVTSACAEHLIKLPSLKQLNLWSTQFGDAGLRLLSEHLTMLQVLNLCE
TPVTDAGLLALSSMKSLCSLNMNSTKLSADTYEDLKAKLPNLKEVDVRYTEAW
Sequence length 773
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
28566273, 30054458, 22158537, 28869590
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Ovarian cancer Ovarian cancer Conditional KD of IL6 in the OCCA xenograft model delays tumor growth GWAS, CBGDA
Hypertension Hypertension GWAS
Associations from Text Mining
Disease Name Relationship Type References
Diabetes Mellitus Type 2 Associate 24086726, 29597287, 29691896, 31145772
Glioma Associate 28744466
Glomerulonephritis IGA Associate 33112407
Glomerulonephritis Membranous Associate 23302718
Hematuria Associate 30439969
Immunoglobulin G4 Related Disease Associate 21457949
Kidney Diseases Stimulate 30439969
Language Disorders Associate 19646677, 21457949
Lupus Nephritis Associate 30439969
Malocclusion Angle Class I Stimulate 30439969