Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80777
Gene name Gene Name - the full gene name approved by the HGNC.
Cytochrome b5 type B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CYB5B
Synonyms (NCBI Gene) Gene synonyms aliases
CYB5-M, CYPB5M, OMB5
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q22.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025368 hsa-miR-34a-5p Proteomics 21566225
MIRT025368 hsa-miR-34a-5p Proteomics 21566225
MIRT046142 hsa-miR-30b-5p CLASH 23622248
MIRT038950 hsa-miR-28-3p CLASH 23622248
MIRT036444 hsa-miR-1226-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25616068, 32296183
GO:0005739 Component Mitochondrion IEA
GO:0005741 Component Mitochondrial outer membrane IBA
GO:0005741 Component Mitochondrial outer membrane IEA
GO:0005741 Component Mitochondrial outer membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611964 24374 ENSG00000103018
Protein
UniProt ID O43169
Protein name Cytochrome b5 type B (Cytochrome b5 outer mitochondrial membrane isoform)
Protein function Cytochrome b5 is a membrane-bound hemoprotein functioning as an electron carrier for several membrane-bound oxygenases.
PDB 3NER
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00173 Cyt-b5 28 100 Cytochrome b5-like Heme/Steroid binding domain Domain
Sequence
MSGSMATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHP
GGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIH
PSDLKPESGSKDPSKNDTCK
SCWAYWILPIIGAVLLGFLYRYYTSESKSS
Sequence length 150
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Phase I - Functionalization of compounds
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cholelithiasis Cholelithiasis N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Diabetes Type 2 diabetes (PheCode 250.2), Type 2 diabetes N/A N/A GWAS
Heart Failure Heart failure N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Hodgkin Disease Associate 20100355
Hypertension Associate 25189868
Lymphoma Non Hodgkin Associate 20100355
Mitochondrial Diseases Associate 38286121
Personality Disorders Associate 20100355