Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80762
Gene name Gene Name - the full gene name approved by the HGNC.
Nedd4 family interacting protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NDFIP1
Synonyms (NCBI Gene) Gene synonyms aliases
N4WBP5
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q31.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to a small group of evolutionarily conserved proteins with three transmembrane domains. It is a potential target for ubiquitination by the Nedd4 family of proteins. This protein is thought to be part of a family of
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024174 hsa-miR-221-3p Sequencing 20371350
MIRT028563 hsa-miR-30a-5p Proteomics 18668040
MIRT048220 hsa-miR-196a-5p CLASH 23622248
MIRT046433 hsa-miR-15b-5p CLASH 23622248
MIRT043897 hsa-miR-378a-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0002761 Process Regulation of myeloid leukocyte differentiation IEA
GO:0002829 Process Negative regulation of type 2 immune response IEA
GO:0005515 Function Protein binding IPI 18776082, 19706893, 25631046, 26363003, 32296183
GO:0005576 Component Extracellular region IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612050 17592 ENSG00000131507
Protein
UniProt ID Q9BT67
Protein name NEDD4 family-interacting protein 1 (Breast cancer-associated protein SGA-1M) (NEDD4 WW domain-binding protein 5) (Putative MAPK-activating protein PM13) (Putative NF-kappa-B-activating protein 164) (Putative NFKB and MAPK-activating protein)
Protein function Activates HECT domain-containing E3 ubiquitin-protein ligases, including NEDD4 and ITCH, and consequently modulates the stability of their targets. As a result, controls many cellular processes. Prevents chronic T-helper cell-mediated inflammati
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10176 DUF2370 54 173 Protein of unknown function (DUF2370) Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Higher levels are detected in cerebellum, pituitary, thalamus, kidney, liver, testis, salivary glands and placenta. Also expressed in fetal brain, kidney and lung. {ECO:0000269|PubMed:11748237}.
Sequence
MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESG
FPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFML
TFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGY
FDGQYWL
WWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY
Sequence length 221
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma, Age of onset of adult onset asthma, Asthma (childhood onset), Age of onset of childhood onset asthma, Nonatopic asthma, Asthma in any disease, Atopic asthma, Asthma (adult onset) N/A N/A GWAS
Biliary Cholangitis Primary biliary cholangitis N/A N/A GWAS
Breast Cancer Breast cancer N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Asthma Associate 21907864, 25997986
Uveal melanoma Associate 29333944