LY6G5C (lymphocyte antigen 6 family member G5C)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80741
Gene name Gene Name - the full gene name approved by the HGNC.
Lymphocyte antigen 6 family member G5C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LY6G5C
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf20, G5C, LY6G5CA, LY6G5CB, NG33
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.
LY6G5C belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(11)
miRTarBase ID miRNA Experiments Reference
MIRT2265230 hsa-miR-3125 CLIP-seq
MIRT2265231 hsa-miR-3916 CLIP-seq
MIRT2265232 hsa-miR-4496 CLIP-seq
MIRT2265233 hsa-miR-4505 CLIP-seq
MIRT2390401 hsa-miR-1321 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0009897 Component External side of plasma membrane IBA
GO:0009897 Component External side of plasma membrane IDA 17008713
GO:0009897 Component External side of plasma membrane IEA
GO:0032991 Component Protein-containing complex IDA 17008713
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
610434 13932 ENSG00000204428
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q5SRR4
Protein name Lymphocyte antigen 6 complex locus protein G5c
Protein function May have a role in hematopoietic cell differentiation.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Detected in T-cell lines and fetal and adult lung. {ECO:0000269|PubMed:12079290}.
Sequence 
MRFMAGPAGSQSLGPLCFHSSPQALYTVLLIVLVMMSLVFGKFVPVNWEPPQPLPFPKYL
RCYRCLLETKELGCLLGSDICLTPAGSSCITLHKKNSSGSDVMVSDCRSKEQMSDCSNTR
TSPVSGFWIFSQYCFLDFCNDPQNRGLYTP
Sequence length 150
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Sarcoidosis Sarcoidosis N/A N/A GWAS
Takayasu Arteritis Takayasu arteritis N/A N/A GWAS