Gene Gene information from NCBI Gene database.
Entrez ID 80740
Gene name Lymphocyte antigen 6 family member G6C
Gene symbol LY6G6C
Synonyms (NCBI Gene)
C6orf24G6cNG24
Chromosome 6
Chromosome location 6p21.33
Summary LY6G6C belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most
miRNA miRNA information provided by mirtarbase database.
48
miRTarBase ID miRNA Experiments Reference
MIRT1122851 hsa-miR-1294 CLIP-seq
MIRT1122852 hsa-miR-1297 CLIP-seq
MIRT1122853 hsa-miR-1470 CLIP-seq
MIRT1122854 hsa-miR-1972 CLIP-seq
MIRT1122855 hsa-miR-2110 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region TAS
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0009897 Component External side of plasma membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610435 13936 ENSG00000204421
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95867
Protein name Lymphocyte antigen 6 complex locus protein G6c
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed at the leading edges of cells, on filopodia. {ECO:0000269|PubMed:17008713}.
Sequence
MKALMLLTLSVLLCWVSADIRCHSCYKVPVLGCVDRQSCRLEPGQQCLTTHAYLGKMWVF
SNLRCGTPEEPCQEAFNQTNRKLGLTYNTTCCNKDNCNSAGPRPTPALGLVFLTSLAGLG
LWLLH
Sequence length 125
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Post-translational modification: synthesis of GPI-anchored proteins