Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80740
Gene name Gene Name - the full gene name approved by the HGNC.
Lymphocyte antigen 6 family member G6C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LY6G6C
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf24, G6c, NG24
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.
LY6G6C belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1122851 hsa-miR-1294 CLIP-seq
MIRT1122852 hsa-miR-1297 CLIP-seq
MIRT1122853 hsa-miR-1470 CLIP-seq
MIRT1122854 hsa-miR-1972 CLIP-seq
MIRT1122855 hsa-miR-2110 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region TAS
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0009897 Component External side of plasma membrane IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610435 13936 ENSG00000204421
Protein
UniProt ID O95867
Protein name Lymphocyte antigen 6 complex locus protein G6c
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed at the leading edges of cells, on filopodia. {ECO:0000269|PubMed:17008713}.
Sequence
MKALMLLTLSVLLCWVSADIRCHSCYKVPVLGCVDRQSCRLEPGQQCLTTHAYLGKMWVF
SNLRCGTPEEPCQEAFNQTNRKLGLTYNTTCCNKDNCNSAGPRPTPALGLVFLTSLAGLG
LWLLH
Sequence length 125
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Post-translational modification: synthesis of GPI-anchored proteins
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypertension Hypertension N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Colorectal Neoplasms Associate 35395711
Coronary Artery Disease Associate 33725943
Mucositis Stimulate 29338018
Sarcoma Kaposi Associate 25008864
Ulcer Associate 29338018