Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	80740
Gene name Gene Name - the full gene name approved by the HGNC.	Lymphocyte antigen 6 family member G6C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LY6G6C
Synonyms (NCBI Gene) Gene synonyms aliases	C6orf24, G6c, NG24
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.	LY6G6C belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most

Show/Hide all(48)

miRTarBase ID	miRNA	Experiments
MIRT1122851	hsa-miR-1294	CLIP-seq
MIRT1122852	hsa-miR-1297	CLIP-seq
MIRT1122853	hsa-miR-1470	CLIP-seq
MIRT1122854	hsa-miR-1972	CLIP-seq
MIRT1122855	hsa-miR-2110	CLIP-seq
MIRT1122856	hsa-miR-26a	CLIP-seq
MIRT1122857	hsa-miR-26b	CLIP-seq
MIRT1122858	hsa-miR-3144-5p	CLIP-seq
MIRT1122859	hsa-miR-3150a-3p	CLIP-seq
MIRT1122860	hsa-miR-3175	CLIP-seq
MIRT1122861	hsa-miR-3189-5p	CLIP-seq
MIRT1122862	hsa-miR-3191	CLIP-seq
MIRT1122863	hsa-miR-3614-3p	CLIP-seq
MIRT1122864	hsa-miR-3675-5p	CLIP-seq
MIRT1122865	hsa-miR-3688-3p	CLIP-seq
MIRT1122866	hsa-miR-3978	CLIP-seq
MIRT1122867	hsa-miR-4260	CLIP-seq
MIRT1122868	hsa-miR-4265	CLIP-seq
MIRT1122869	hsa-miR-4296	CLIP-seq
MIRT1122870	hsa-miR-4300	CLIP-seq
MIRT1122871	hsa-miR-4322	CLIP-seq
MIRT1122872	hsa-miR-4323	CLIP-seq
MIRT1122873	hsa-miR-4420	CLIP-seq
MIRT1122874	hsa-miR-4465	CLIP-seq
MIRT1122875	hsa-miR-4648	CLIP-seq
MIRT1122876	hsa-miR-4650-5p	CLIP-seq
MIRT1122877	hsa-miR-4652-5p	CLIP-seq
MIRT1122878	hsa-miR-4654	CLIP-seq
MIRT1122879	hsa-miR-4667-3p	CLIP-seq
MIRT1122880	hsa-miR-4667-5p	CLIP-seq
MIRT1122881	hsa-miR-4694-3p	CLIP-seq
MIRT1122882	hsa-miR-4698	CLIP-seq
MIRT1122883	hsa-miR-4700-5p	CLIP-seq
MIRT1122884	hsa-miR-4733-5p	CLIP-seq
MIRT1122885	hsa-miR-4769-5p	CLIP-seq
MIRT1122886	hsa-miR-496	CLIP-seq
MIRT1122887	hsa-miR-583	CLIP-seq
MIRT1122888	hsa-miR-920	CLIP-seq
MIRT1122889	hsa-miR-922	CLIP-seq
MIRT1122890	hsa-miR-939	CLIP-seq
MIRT1122852	hsa-miR-1297	CLIP-seq
MIRT1122853	hsa-miR-1470	CLIP-seq
MIRT1122856	hsa-miR-26a	CLIP-seq
MIRT1122857	hsa-miR-26b	CLIP-seq
MIRT1122874	hsa-miR-4465	CLIP-seq
MIRT1122879	hsa-miR-4667-3p	CLIP-seq
MIRT1122889	hsa-miR-922	CLIP-seq
MIRT1122851	hsa-miR-1294	CLIP-seq

Show/Hide all(9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0009897	Component	External side of plasma membrane	IDA	17008713
GO:0031225	Component	Anchored component of membrane	IEA
GO:0032991	Component	Protein-containing complex	IBA	21873635
GO:0032991	Component	Protein-containing complex	IDA	17008713
GO:0042802	Function	Identical protein binding	IDA	17008713

MIM	HGNC	e!Ensembl
610435	13936	ENSG00000204421

Protein

UniProt ID

O95867

Protein name

Lymphocyte antigen 6 complex locus protein G6c

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Highly expressed at the leading edges of cells, on filopodia. {ECO:0000269|PubMed:17008713}.

Sequence

MKALMLLTLSVLLCWVSADIRCHSCYKVPVLGCVDRQSCRLEPGQQCLTTHAYLGKMWVF
SNLRCGTPEEPCQEAFNQTNRKLGLTYNTTCCNKDNCNSAGPRPTPALGLVFLTSLAGLG
LWLLH

Sequence length

125

Interactions

View interactions

	Reactome
			Post-translational modification: synthesis of GPI-anchored proteins

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	17632545
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	21156761

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Hypertension	Hypertension			GWAS

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining
Colorectal Neoplasms	Associate	35395711
Coronary Artery Disease	Associate	33725943
Mucositis	Stimulate	29338018
Sarcoma Kaposi	Associate	25008864
Ulcer	Associate	29338018

LY6G6C (lymphocyte antigen 6 family member G6C)