Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8074
Gene name	Fibroblast growth factor 23
Gene symbol	FGF23
Synonyms (NCBI Gene)	ADHRFGFNHFTC2HPDR2HYPFPHPTC
Chromosome	12
Chromosome location	12p13.32
Summary	This gene encodes a member of the fibroblast growth factor family of proteins, which possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. The product of this gene regulates phosphate homeostasis and t

Show/Hide all (11)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28937882	G>A,T	Likely-pathogenic, pathogenic	Missense variant, synonymous variant, coding sequence variant
rs104894342	T>C	Pathogenic, likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs104894343	A>G	Pathogenic	Coding sequence variant, missense variant
rs104894344	G>A	Pathogenic	Coding sequence variant, missense variant
rs104894347	C>T	Pathogenic	Coding sequence variant, missense variant
rs193922701	C>G	Likely-pathogenic	Missense variant, coding sequence variant
rs193922702	C>T	Pathogenic	Missense variant, coding sequence variant
rs863224872	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1064795205	C>T	Likely-pathogenic	Stop gained, coding sequence variant
rs1220533001	C>A,G	Pathogenic	Missense variant, coding sequence variant
rs1555096583	A>G	Pathogenic	Missense variant, coding sequence variant

Show/Hide all (62)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017013	hsa-miR-335-5p	Microarray	18185580
MIRT029016	hsa-miR-26b-5p	Microarray	19088304
MIRT995668	hsa-miR-1273d	CLIP-seq
MIRT995669	hsa-miR-1276	CLIP-seq
MIRT995670	hsa-miR-1286	CLIP-seq
MIRT995671	hsa-miR-1321	CLIP-seq
MIRT995672	hsa-miR-140-3p	CLIP-seq
MIRT995673	hsa-miR-186	CLIP-seq
MIRT995674	hsa-miR-1910	CLIP-seq
MIRT995675	hsa-miR-1912	CLIP-seq
MIRT995676	hsa-miR-3119	CLIP-seq
MIRT995677	hsa-miR-3133	CLIP-seq
MIRT995678	hsa-miR-3148	CLIP-seq
MIRT995679	hsa-miR-335	CLIP-seq
MIRT995680	hsa-miR-3936	CLIP-seq
MIRT995681	hsa-miR-4293	CLIP-seq
MIRT995682	hsa-miR-4311	CLIP-seq
MIRT995683	hsa-miR-4419a	CLIP-seq
MIRT995684	hsa-miR-4510	CLIP-seq
MIRT995685	hsa-miR-455-3p	CLIP-seq
MIRT995686	hsa-miR-4659a-5p	CLIP-seq
MIRT995687	hsa-miR-4659b-5p	CLIP-seq
MIRT995688	hsa-miR-4722-5p	CLIP-seq
MIRT995689	hsa-miR-4729	CLIP-seq
MIRT995690	hsa-miR-4739	CLIP-seq
MIRT995691	hsa-miR-4756-5p	CLIP-seq
MIRT995692	hsa-miR-4776-3p	CLIP-seq
MIRT995693	hsa-miR-4786-5p	CLIP-seq
MIRT995694	hsa-miR-583	CLIP-seq
MIRT995695	hsa-miR-591	CLIP-seq
MIRT995668	hsa-miR-1273d	CLIP-seq
MIRT995675	hsa-miR-1912	CLIP-seq
MIRT1995258	hsa-miR-2278	CLIP-seq
MIRT1995259	hsa-miR-3127-3p	CLIP-seq
MIRT1995260	hsa-miR-3161	CLIP-seq
MIRT1995261	hsa-miR-323b-3p	CLIP-seq
MIRT1995262	hsa-miR-34a	CLIP-seq
MIRT1995263	hsa-miR-34c-5p	CLIP-seq
MIRT1995264	hsa-miR-4274	CLIP-seq
MIRT1995265	hsa-miR-449a	CLIP-seq
MIRT1995266	hsa-miR-449b	CLIP-seq
MIRT1995267	hsa-miR-4501	CLIP-seq
MIRT1995268	hsa-miR-539	CLIP-seq
MIRT1995269	hsa-miR-548a-3p	CLIP-seq
MIRT1995270	hsa-miR-548e	CLIP-seq
MIRT1995271	hsa-miR-548f	CLIP-seq
MIRT2229365	hsa-miR-1290	CLIP-seq
MIRT2229366	hsa-miR-3152-5p	CLIP-seq
MIRT2229367	hsa-miR-3167	CLIP-seq
MIRT2229368	hsa-miR-326	CLIP-seq
MIRT2229369	hsa-miR-330-5p	CLIP-seq
MIRT2229370	hsa-miR-4297	CLIP-seq
MIRT2229371	hsa-miR-4700-3p	CLIP-seq
MIRT2229372	hsa-miR-4774-3p	CLIP-seq
MIRT2229373	hsa-miR-4782-5p	CLIP-seq
MIRT2229374	hsa-miR-876-5p	CLIP-seq
MIRT2229375	hsa-miR-942	CLIP-seq
MIRT1995260	hsa-miR-3161	CLIP-seq
MIRT1995261	hsa-miR-323b-3p	CLIP-seq
MIRT1995269	hsa-miR-548a-3p	CLIP-seq
MIRT1995270	hsa-miR-548e	CLIP-seq
MIRT1995271	hsa-miR-548f	CLIP-seq

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0005104	Function	Fibroblast growth factor receptor binding	IEA
GO:0005105	Function	Type 1 fibroblast growth factor receptor binding	IBA
GO:0005105	Function	Type 1 fibroblast growth factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	17086194, 19966287, 35512704
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	16638743
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0010966	Process	Regulation of phosphate transport	IDA	11409890
GO:0010980	Process	Positive regulation of vitamin D 24-hydroxylase activity	IDA	15040831
GO:0022008	Process	Neurogenesis	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030334	Process	Regulation of cell migration	IBA
GO:0030500	Process	Regulation of bone mineralization	IEA
GO:0030502	Process	Negative regulation of bone mineralization	IDA	18282132
GO:0030643	Process	Intracellular phosphate ion homeostasis	IEA
GO:0032026	Process	Response to magnesium ion	IEA
GO:0042359	Process	Vitamin D metabolic process	IEA
GO:0042369	Process	Vitamin D catabolic process	IDA	15040831
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0044320	Process	Cellular response to leptin stimulus	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IDA	18282132
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046888	Process	Negative regulation of hormone secretion	IEA
GO:0046888	Process	Negative regulation of hormone secretion	ISS
GO:0055062	Process	Phosphate ion homeostasis	IMP	11062477
GO:0055074	Process	Calcium ion homeostasis	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071305	Process	Cellular response to vitamin D	IEA
GO:0071354	Process	Cellular response to interleukin-6	IEA
GO:0071374	Process	Cellular response to parathyroid hormone stimulus	IEA
GO:0090080	Process	Positive regulation of MAPKKK cascade by fibroblast growth factor receptor signaling pathway	IEA
GO:1904383	Process	Response to sodium phosphate	IEA

MIM	HGNC	e!Ensembl
605380	3680	ENSG00000118972

Q9GZV9

Protein name

Fibroblast growth factor 23 (FGF-23) (Phosphatonin) (Tumor-derived hypophosphatemia-inducing factor) [Cleaved into: Fibroblast growth factor 23 N-terminal peptide; Fibroblast growth factor 23 C-terminal peptide]

Protein function

Regulator of phosphate homeostasis (PubMed:11062477). Inhibits renal tubular phosphate transport by reducing SLC34A1 levels (PubMed:11409890). Up-regulates EGR1 expression in the presence of KL (By similarity). Acts directly on the parathyroid t

PDB

2P39 , 5W21 , 6S22 , 7YSH , 7YSU , 7YSW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00167	FGF	39 → 150	Fibroblast growth factor	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in osteogenic cells particularly during phases of active bone remodeling. In adult trabecular bone, expressed in osteocytes and flattened bone-lining cells (inactive osteoblasts). {ECO:0000269|PubMed:12952917}.

Sequence

MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGH
VDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTL
ENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRS
AEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTG
PEGCRPFAKFI

Sequence length

251

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway PI3K-Akt signaling pathway Regulation of actin cytoskeleton Parathyroid hormone synthesis, secretion and action Pathways in cancer Melanoma Breast cancer Gastric cancer		PI3K Cascade PIP3 activates AKT signaling Signaling by activated point mutants of FGFR1 Signaling by activated point mutants of FGFR3 FGFR4 ligand binding and activation FGFR3c ligand binding and activation FGFR1c ligand binding and activation FGFR1c and Klotho ligand binding and activation FGFR2c ligand binding and activation FGFR3 mutant receptor activation Activated point mutants of FGFR2 Constitutive Signaling by Aberrant PI3K in Cancer Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Phospholipase C-mediated cascade: FGFR1 Phospholipase C-mediated cascade; FGFR2 Phospholipase C-mediated cascade; FGFR3 Phospholipase C-mediated cascade; FGFR4 Downstream signaling of activated FGFR1 SHC-mediated cascade:FGFR1 PI-3K cascade:FGFR1 FRS-mediated FGFR1 signaling PI-3K cascade:FGFR2 SHC-mediated cascade:FGFR2 FRS-mediated FGFR2 signaling SHC-mediated cascade:FGFR3 FRS-mediated FGFR3 signaling PI-3K cascade:FGFR3 FRS-mediated FGFR4 signaling SHC-mediated cascade:FGFR4 PI-3K cascade:FGFR4 Negative regulation of FGFR1 signaling Negative regulation of FGFR2 signaling Negative regulation of FGFR3 signaling Negative regulation of FGFR4 signaling Signaling by FGFR2 in disease Signaling by FGFR1 in disease FGFRL1 modulation of FGFR1 signaling RAF/MAP kinase cascade PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Signaling by FGFR3 point mutants in cancer Post-translational protein phosphorylation

220

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autosomal dominant hypophosphatemic rickets	Pathogenic; Likely pathogenic	rs104894347, rs28937882, rs2497236074, rs193922701, rs193922702	RCV000005328 RCV000005329 RCV003476889 RCV000029797 RCV000029798
Familial hyperphosphatemic tumoral calcinosis/hyperphosphatemic hyperostosis syndrome	Likely pathogenic	rs863224872	RCV000197637
Hypophosphatemic rickets	Pathogenic	rs193922702	RCV001843462
Short stature	Pathogenic	rs193922702	RCV005245482
Tumoral calcinosis, hyperphosphatemic, familial, 1	Likely pathogenic; Pathogenic	rs1555096583, rs1220533001	RCV000513167 RCV000513584
Tumoral calcinosis, hyperphosphatemic, familial, 2	Pathogenic; Likely pathogenic	rs104894343, rs104894344, rs1555096583, rs193922702	RCV000005331 RCV000005332 RCV001796086 RCV002482917

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
FGF23-related disorder	Likely benign; Benign	rs1429413031, rs13312792	RCV003904352 RCV003968375
Hypophosphatemic Rickets, Dominant	Uncertain significance	rs550329870, rs886049403, rs886049402, rs886049407, rs58735464, rs886049406	RCV000302816 RCV000366560 RCV000402355 RCV000373950 RCV000366838 RCV000331971 RCV000372783
See cases	Uncertain significance	rs104894347	RCV004584480

Show/Hide Text Mining Associations (182)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute Kidney Injury	Inhibit	21903990
Amelogenesis Imperfecta	Associate	36351670
Amelogenesis imperfecta local hypoplastic form	Associate	36351670
Aortic Dissection	Stimulate	26558428
Arrhythmias Cardiac	Associate	35008591
Arthritis	Stimulate	37627287
Atherosclerosis	Stimulate	28619026, 31542779
Atrial Fibrillation	Associate	34798808
Bone Diseases	Associate	24006476, 28594289, 32236867
Bone Diseases Metabolic	Associate	31354894, 31648693, 37192015, 40133996
Calcinosis	Associate	18682534, 18982401, 23325605, 25378588, 27164190, 29548779, 31542779, 33685073
Calciphylaxis	Associate	28212442
Camurati Engelmann Syndrome	Associate	27164190
Carcinogenesis	Associate	37242266, 38148081
Carcinoma	Stimulate	30281149
Carcinoma Pancreatic Ductal	Associate	30836094
Carcinoma Squamous Cell	Associate	37249797
Cardiomyopathy Dilated	Associate	36049813, 37749114
Cardiovascular Abnormalities	Associate	24168888
Cardiovascular Diseases	Associate	26681731, 30669147, 33783172, 34387090, 36719157, 37627287
Cardiovascular Diseases	Inhibit	32077150
Cartilage Diseases	Associate	20196777, 21406294, 36799502
Charcot Marie Tooth Disease Dominant Intermediate B	Stimulate	37627287
Cholangiocarcinoma	Associate	28445152
Chronic Kidney Disease Mineral and Bone Disorder	Associate	20150940, 22895520, 23471131, 25343949, 26430087, 28212442, 28784837, 29025789, 30356327, 30862350, 31377240, 33308018
Chronic Kidney Disease Mineral and Bone Disorder	Stimulate	21406294
Cognitive Dysfunction	Associate	30115946
Colonic Neoplasms	Associate	23393166
Colorectal Neoplasms	Associate	24574808, 34469519
Congenital Disorders of Glycosylation	Associate	17129170
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	24553630
Constriction Pathologic	Associate	33413149
Conversion Disorder	Stimulate	23740037
Coronary Artery Disease	Associate	24168888, 35263363
Coronary Disease	Associate	33413149, 35546659
Coronary Restenosis	Associate	33413149
COVID 19	Associate	36672957
Death	Associate	23825530, 28017325, 29113983, 29849175, 37734292
Dental Plaque	Associate	29113983
Diabetes Mellitus	Associate	36907780
Diabetes Mellitus Type 2	Associate	28619026, 29113983, 36907780
Diabetic Angiopathies	Associate	29548779
Diabetic Nephropathies	Stimulate	23302066
Diabetic Nephropathies	Associate	25324042
Diabetic Retinopathy	Associate	32993645
Disease	Associate	36719157, 37627287
Edema	Associate	40661832
End Stage Liver Disease	Associate	23825530
Endocrine System Diseases	Associate	33413149
Essential Hypertension	Associate	29336609, 36907780
Fabry Disease	Associate	12952917, 22247037, 38174586
Familial Hypophosphatemic Rickets	Associate	12711740, 20157195, 21597229, 26135520, 27840894, 29947083, 30075510, 30352126, 30772600, 31151476, 33783172, 34333162, 35654784, 36049757, 36051396 View all (7 more)
Familial paroxysmal dystonia	Associate	33305291
Fibroma	Associate	38303543
Fibrosis	Associate	23867799
Fibrous Dysplasia of Bone	Associate	12952917, 22247037
Fibrous Dysplasia Polyostotic	Associate	12952917, 38174586
Fractures Bone	Associate	20928885
Frailty	Associate	37254268
Genetic Diseases Inborn	Associate	22075221
Graft vs Host Disease	Stimulate	34333162
Growth Disorders	Associate	29190002
Hearing Loss	Stimulate	36649363
Heart Diseases	Stimulate	24459137
Heart Diseases	Associate	25217649, 35008591, 37749114
Heart Failure	Associate	23740037, 23825530, 30912310, 35008591, 35902130, 37734292
Heart Failure	Stimulate	30256890
Heart Failure Diastolic	Associate	34685778
Heart Failure Systolic	Associate	35595781
Hemolytic Uremic Syndrome	Associate	19890272
Hip Fractures	Stimulate	20928885
Hypercalcemia	Associate	24670087, 36672957
Hypercholesterolemia	Associate	33413149
Hyperostosis	Associate	40661832
Hyperparathyroidism Primary	Associate	37065752
Hyperparathyroidism Secondary	Associate	19890272, 20150940, 20593414, 30669147
Hyperparathyroidism Secondary	Stimulate	21389978
Hyperphosphatemia	Associate	17129170, 18982401, 20358599, 21389978, 21406294, 25378588, 27164190, 32360901
Hyperphosphatemia	Inhibit	20593414
Hypertension	Associate	34960084, 36907780
Hypertrophy	Associate	22393163, 24620922
Hypertrophy	Stimulate	29025789, 30256890, 35008591
Hypertrophy Left Ventricular	Associate	20593414, 24620922, 29025789
Hypertrophy Left Ventricular	Stimulate	26681731
Hyperuricemia	Associate	33413149
Hypophosphatemia	Associate	12711740, 17227222, 19219382, 23325605, 23393166, 24006476, 24706917, 26135520, 29947083, 31652009, 32384911, 35106857, 36093861, 38148081, 38174586, 38493780, 40323576 View all (2 more)
Hypophosphatemia	Stimulate	21406293
Hypophosphatemia Familial	Associate	12711740, 17033625, 31514490
Hypophosphatemia Familial	Stimulate	29767399
Hypophosphatemia Renal with Intracerebral Calcifications	Associate	30180816
Hypophosphatemic Bone Disease	Associate	20593414, 26135520, 36049757, 36093861
Hypophosphatemic Rickets Autosomal Dominant	Associate	11737582, 12711740, 12952917, 17227222, 18682534, 21880793, 23174215, 31652009, 38493780
Hypophosphatemic Rickets Autosomal Recessive 1	Associate	20499351
Hypophosphatemic Rickets Autosomal Recessive 2	Associate	19007919
Hypoxia	Stimulate	28594289
Inflammation	Stimulate	27742194, 28017325
Inflammation	Associate	31075857, 33413149, 35595781
Insulin Resistance	Associate	33413149
Iron Deficiencies	Associate	26453792, 31170159, 33675347
Iron Deficiencies	Stimulate	31652009
Kidney Diseases	Associate	21852584, 24459137, 25060052, 25324042, 26453792, 27005479, 28705885, 36226529, 36907780
Kidney Failure Chronic	Stimulate	20593414, 25060052
Kidney Failure Chronic	Associate	21903990, 25200959, 32077150
Kidney Neoplasms	Associate	28705885
Liposarcoma Myxoid	Associate	26956379
Liver Diseases	Stimulate	23825530
Low Back Pain	Associate	18379151
Lupus Erythematosus Systemic	Associate	37627287
Malignant mesenchymal tumor	Associate	18379151, 26956379, 27443518, 31792355, 37742927, 38303543
Malignant mesenchymal tumor	Stimulate	29380000
Malnutrition	Associate	24947687
Malocclusion	Associate	28257739
Malocclusion Angle Class III	Associate	26059428, 28257739
Mental Disorders	Stimulate	24466013
Micrognathism	Associate	35818799
Mitral Valve Insufficiency	Associate	38141725
Mucocutaneous Lymph Node Syndrome	Associate	24168888
Multiple Sclerosis	Inhibit	34745143
Muscle Weakness	Associate	23174215
Musculoskeletal Diseases	Stimulate	37627287
Musculoskeletal Diseases	Associate	40373834
Myotonia with Skeletal Abnormalities and Mental Retardation	Associate	20928885
Neoplasms	Associate	12711740, 18311810, 18379151, 19219382, 19359472, 23393166, 26464698, 32384911, 34469519, 36604721
Neoplasms	Stimulate	12952917, 33462615
Nephrogenic Fibrosing Dermopathy	Associate	23867799
Nephrolithiasis	Associate	36351670
Nephrosis congenital	Stimulate	31354894
Nonseminomatous germ cell tumor	Associate	37242266
Obesity	Associate	22362819
Obesity	Inhibit	31652917
Odontogenic Cyst Calcifying	Associate	24459137
Oncogenic osteomalacia	Associate	18311810, 19219382, 23393166, 26135520, 26464698, 26956379, 27034530, 28982589, 29380000, 32277576, 36093861
Ossification Heterotopic	Associate	23867799
Osteoarthritis	Stimulate	22393163
Osteogenesis Imperfecta	Associate	35052464, 40649786
Osteoma Osteoid	Associate	19679205
Osteomalacia	Associate	12711740, 12952917, 18379151, 19219382, 20593414, 24006476, 28982589, 32384911, 33462615, 36049757, 40133996, 40314226
Osteoporosis	Associate	31968132, 36157448
Osteoporosis	Stimulate	37627287
Osteosarcoma	Associate	36604721
Ovarian Neoplasms	Associate	24146310
Pain	Associate	23174215, 40661832
Pancreatic Intraductal Neoplasms	Associate	30836094
Peripheral Arterial Disease	Associate	39221259
Phosphorus Metabolism Disorders	Associate	21389978
Plaque Atherosclerotic	Associate	24459137
Polycystic Kidney Autosomal Dominant	Associate	28705885, 33305291
Progressive hearing loss stapes fixation	Associate	31068690, 33107440, 36719566
Progressive hearing loss stapes fixation	Stimulate	31104833
Prostatic Neoplasms	Stimulate	30568232
Proteinuria	Associate	25200959, 25324042, 37627287
Pulmonary Disease Chronic Obstructive	Stimulate	31075857
Pulmonary Disease Chronic Obstructive	Associate	35263363
Raine syndrome	Associate	24706917
Renal Insufficiency	Associate	24466013, 33049075
Renal Insufficiency Chronic	Stimulate	19679205, 20150940, 20593414, 21389978, 24459137, 24466013, 26681731
Renal Insufficiency Chronic	Inhibit	21030971
Renal Insufficiency Chronic	Associate	22895520, 23271484, 23825530, 25200959, 25217649, 26390291, 27312441, 28017325, 29461601, 29665793, 30256890, 30669147, 31687048, 33783172, 35587600, 36226529, 36907780, 36970967 View all (3 more)
Rhabdoid Tumor Predisposition Syndrome 1	Associate	37726478
Rickets	Associate	21050253, 23325605, 24006476, 33675347, 38493780
Rickets Hypophosphatemic	Associate	20137772, 21050253, 22075221, 22695891, 26135520, 27840894, 29190002, 35352187, 35999193
Rickets Hypophosphatemic	Stimulate	20137773, 35899574
Scoliosis	Associate	37192015
Seminoma	Associate	37242266
Smith Lemli Opitz Syndrome	Associate	36672957
Somatostatinoma	Associate	33049075
Sotos Syndrome	Associate	24670087
Spondylocostal dysostosis autosomal recessive	Associate	20928885
Syndrome	Associate	26453792, 38250739
Tibial Neuropathy	Associate	36847234
Tooth Loss	Stimulate	21903990
Tumoral Calcinosis Hyperphosphatemic Familial	Associate	16960814, 17129170, 18682534, 18982401, 19865099, 20358599, 27164190, 30015621, 32360901, 33685073, 36213261, 40661832
Tumoral Calcinosis Hyperphosphatemic Familial	Inhibit	32360901
Uremia	Associate	39799338
Vascular Calcification	Associate	20593414, 25378588, 26558428, 39799338
Vascular Calcification	Stimulate	31542779
Vascular Diseases	Associate	25324042
Vasculitis Leukocytoclastic Cutaneous	Associate	24006476
Ventricular Dysfunction Right	Associate	37749114
Ventricular Remodeling	Associate	25217649, 26681731
Ventricular Remodeling	Stimulate	35902130
Wasting Syndrome	Associate	11737582, 12952917, 23393166, 24006476, 29947083, 40323576

FGF23 (fibroblast growth factor 23)