Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80736
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 44 member 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC44A4
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf29, CTL4, DFNA72, NG22, TPPT, hTPPT1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene may be a sodium-dependent transmembrane transport protein involved in the uptake of choline by cholinergic neurons. Defects in this gene can cause sialidosis, a lysosomal storage disease. Three transcript variants encoding
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1135402753 T>C Pathogenic Intron variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1364441 hsa-miR-122 CLIP-seq
MIRT1364442 hsa-miR-125a-3p CLIP-seq
MIRT1364443 hsa-miR-1307 CLIP-seq
MIRT1364444 hsa-miR-1976 CLIP-seq
MIRT1364445 hsa-miR-3198 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 24379411
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0006656 Process Phosphatidylcholine biosynthetic process IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606107 13941 ENSG00000204385
Protein
UniProt ID Q53GD3
Protein name Choline transporter-like protein 4 (Solute carrier family 44 member 4) (Thiamine pyrophosphate transporter 1) (hTPPT1)
Protein function Choline transporter that plays a role in the choline-acetylcholine system and is required to the efferent innervation of hair cells in the olivocochlear bundle for the maintenance of physiological function of outer hair cells and the protection
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04515 Choline_transpo 314 675 Plasma-membrane choline transporter Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in colon, also detected in prostate, trachea and lung (PubMed:24379411). Isoform 3 is also expressed in colon but a lower levels (PubMed:24379411). {ECO:0000269|PubMed:24379411}.; TISSUE SPECIFICITY: [Isoform 3]: Expre
Sequence
MGGKQRDEDDEAYGKPVKYDPSFRGPIKNRSCTDVICCVLFLLFILGYIVVGIVAWLYGD
PRQVLYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSC
PEDPWTVGKNEFSQTVGEVFYTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGR
CFPWTNVTPPALPGITNDTTIQQGISGLIDSLNARDISVKIFEDFAQSWYWILVALGVAL
VLSLLFILLLRLVAGPLVLVLILGVLGVLAYGIYYCWEEYRVLRDKGASISQLGFTTNLS
AYQSVQETWLAALIVLAVLEAILLLMLIFLRQRIRIAIALLKEASKAVGQMMSTMFYPLV
TFVLLLICIAYWAMTALYLATSGQPQYVLWASNISSPGCEKVPINTSCNPTAHLVNSSCP
GLMCVFQGYSSKGLIQRSVFNLQIYGVLGLFWTLNWVLALGQCVLAGAFASFYWAFHKPQ
DIPTFPLISAFIRTLRYHTGSLAFGALILTLVQIARVILEYIDHKLRGVQNPVARCIMCC
FKCCLWCLEKFIKFLNRNAYIMIAIYGKNFCVSAKNAFMLLMRNIVRVVVLDKVTDLLLF
FGKLLVVGGVGVLSFFFFSGRIPGLGKDFKSPHLNYYWLPIMTSILGAYVIASGFFSVFG
MCVDTLFLCFLEDLE
RNNGSLDRPYYMSKSLLKILGKKNEAPPDNKKRKK
Sequence length 710
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Choline metabolism in cancer   Synthesis of PC
Transport of bile salts and organic acids, metal ions and amine compounds
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Atopic asthma N/A N/A GWAS
Deafness hearing loss, autosomal dominant 72, autosomal dominant nonsyndromic hearing loss N/A N/A GenCC
Exudative Macular Degeneration Exudative age-related macular degeneration N/A N/A GWAS
Hearing Loss Hearing loss, autosomal dominant 72 N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Habitual Stimulate 37685876
Alzheimer Disease Associate 37925455
Carcinoma Renal Cell Associate 32461965, 38268058
Colitis Ulcerative Associate 27759029
Lung Neoplasms Associate 23651124
Macular Degeneration Associate 25629512
Mucolipidoses Associate 12067718