PBX4 (PBX homeobox 4)

Gene

• Entrez ID: 80714
• Gene name: PBX homeobox 4
• Gene symbol: PBX4
• Synonyms (NCBI Gene): -
• Chromosome: 19
• Chromosome location: 19p13.11
• Summary: This gene encodes a member of the pre-B cell leukemia transcription factor family. These proteins are homeobox proteins that play critical roles in embryonic development and cellular differentiation both as Hox cofactors and through Hox-independent pathwa

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1216168	hsa-miR-4303	CLIP-seq
MIRT1216169	hsa-miR-4649-3p	CLIP-seq
MIRT1216170	hsa-miR-4762-3p	CLIP-seq
MIRT1216171	hsa-miR-629	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001654	Process	Eye development	IBA
GO:0001741	Component	XY body	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 29892012, 31515488, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IC	11335119
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007420	Process	Brain development	IBA
GO:0009887	Process	Animal organ morphogenesis	IBA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	ISS	11335119
GO:0045893	Process	Positive regulation of DNA-templated transcription	IC	11335119
GO:0048568	Process	Embryonic organ development	IBA
GO:0048666	Process	Neuron development	IBA

Other IDs

• MIM: 608127
• HGNC: 13403
• e!Ensembl: ENSG00000105717

Protein

• UniProt ID: Q9BYU1
• Protein name: Pre-B-cell leukemia transcription factor 4 (Homeobox protein PBX4)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03792	PBC	16 → 209	PBC domain	Family
  PF00046	Homeodomain	211 → 270	Homeodomain	Domain

• Sequence:

  MAAPPRPAPSPPAPRRLDTSDVLQQIMAITDQSLDEAQARKHALNCHRMKPALFSVLCEI
  KEKTVVSIRGIQDEDPPDAQLLRLDNMLLAEGVCRPEKRGRGGAVARAGTATPGGCPNDN
  SIEHSDYRAKLSQIRQIYHSELEKYEQACREFTTHVTNLLQEQSRMRPVSPKEIERMVGA
  IHGKFSAIQMQLKQSTCEAVMTLRSRLLDARRKRRNFSKQATEVLNEYFYSHLNNPYPSE
  EAKEELARKGGLTISQVSNWFGNKRIRYKKNMGKFQEEATIYTGKTAVDTTEVGVPGNHA
  SCLSTPSSGSSGPFPLPSAGDAFLTLRTLASLQPPPGGGCLQSQAQGSWQGATPQPATAS
  PAGDPGSINSSTSN

• Sequence length: 374