Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8048
Gene name Gene Name - the full gene name approved by the HGNC.
Cysteine and glycine rich protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CSRP3
Synonyms (NCBI Gene) Gene synonyms aliases
CLP, CMD1M, CMH12, CRP3, LMO4, MLP
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of prote
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs13451 C>G,T Likely-benign, benign, likely-pathogenic Synonymous variant, coding sequence variant
rs104894204 A>C Pathogenic Missense variant, intron variant, coding sequence variant
rs104894205 A>G Uncertain-significance, likely-pathogenic, pathogenic-likely-pathogenic Missense variant, intron variant, coding sequence variant
rs137852764 T>C Uncertain-significance, pathogenic Coding sequence variant, intron variant, missense variant
rs137852765 T>G Uncertain-significance, pathogenic Coding sequence variant, intron variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT637238 hsa-miR-6875-3p HITS-CLIP 23824327
MIRT637237 hsa-miR-4659a-3p HITS-CLIP 23824327
MIRT637236 hsa-miR-4659b-3p HITS-CLIP 23824327
MIRT637238 hsa-miR-6875-3p HITS-CLIP 23824327
MIRT637237 hsa-miR-4659a-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002026 Process Regulation of the force of heart contraction IEA
GO:0002026 Process Regulation of the force of heart contraction ISS
GO:0003300 Process Cardiac muscle hypertrophy IMP 12507422
GO:0003779 Function Actin binding IEA
GO:0005515 Function Protein binding IPI 12127981, 15205937, 15582318, 24860983, 32814053
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600824 2472 ENSG00000129170
Protein
UniProt ID P50461
Protein name Cysteine and glycine-rich protein 3 (Cardiac LIM protein) (Cysteine-rich protein 3) (CRP3) (LIM domain protein, cardiac) (Muscle LIM protein)
Protein function Positive regulator of myogenesis. Acts as a cofactor for myogenic bHLH transcription factors such as MYOD1, and probably MYOG and MYF6. Enhances the DNA-binding activity of the MYOD1:TCF3 isoform E47 complex and may promote formation of a functi
PDB 2O10 , 2O13
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00412 LIM 10 66 LIM domain Domain
PF00412 LIM 120 176 LIM domain Domain
Tissue specificity TISSUE SPECIFICITY: Cardiac and slow-twitch skeletal muscles. Isoform 2 is expressed in striated muscle. Isoform 2 is specifically expressed at higher levels in patients with neuromuscular diseases, such as limb-girdle muscular dystrophy 2A (LGMD2A), Duch
Sequence
MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKV
CYGRRY
GPKGIGYGQGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKC
PRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNF
GPTG
IGFGGLTQQVEKKE
Sequence length 194
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Cytoskeleton in muscle cells  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
cardiomyopathy Cardiomyopathy rs902082118, rs761507504 N/A
Cardiomyopathy Primary dilated cardiomyopathy rs1565050320, rs876657767, rs1565053085, rs1565053147 N/A
Hypertrophic Cardiomyopathy Primary familial hypertrophic cardiomyopathy, Hypertrophic cardiomyopathy 12 rs761507504, rs104894204, rs281865416 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Dilated Cardiomyopathy Dilated Cardiomyopathy, Dominant N/A N/A ClinVar
Myopathy dilated cardiomyopathy 1M, dilated cardiomyopathy N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Cardiomegaly Associate 35384713
Cardiomyopathies Associate 22194935, 29222138, 33176267, 35241752, 36270459
Cardiomyopathy Dilated Associate 15582318, 16352453, 20201937, 31406109, 33176267, 35241752
Cardiomyopathy Hypertrophic Associate 15582318, 16352453, 22429680, 30681346, 31406109, 31919335, 35241752, 35384713, 37431535, 39971408
Cardiomyopathy Hypertrophic Familial Associate 35384713
familial dilated cardiomyopathy Associate 19412328
Heart Failure Associate 31406109, 33176267
Hypertrophy Associate 33176267
Hypertrophy Left Ventricular Associate 30681346
Mitochondrial Diseases Associate 31406109