Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	80352
Gene name Gene Name - the full gene name approved by the HGNC.	Ring finger protein 39
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RNF39
Synonyms (NCBI Gene) Gene synonyms aliases	FAP216, HZF, HZFW, LIRF
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p22.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene lies within the major histocompatibility complex class I region on chromosome 6. Studies of a similar rat protein suggest that this gene encodes a protein that plays a role in an early phase of synaptic plasticity. Multiple transcript variants e

Show/Hide all(77)

miRTarBase ID	miRNA	Experiments
MIRT1312903	hsa-miR-1257	CLIP-seq
MIRT1312904	hsa-miR-1278	CLIP-seq
MIRT1312905	hsa-miR-3918	CLIP-seq
MIRT1312906	hsa-miR-4434	CLIP-seq
MIRT1312907	hsa-miR-4481	CLIP-seq
MIRT1312908	hsa-miR-4516	CLIP-seq
MIRT1312909	hsa-miR-4745-5p	CLIP-seq
MIRT1312910	hsa-miR-4758-5p	CLIP-seq
MIRT1312911	hsa-miR-4790-3p	CLIP-seq
MIRT1312912	hsa-miR-873	CLIP-seq
MIRT2093077	hsa-miR-200b	CLIP-seq
MIRT2093078	hsa-miR-200c	CLIP-seq
MIRT2093079	hsa-miR-2052	CLIP-seq
MIRT2093080	hsa-miR-2681	CLIP-seq
MIRT2093081	hsa-miR-3150a-3p	CLIP-seq
MIRT2093082	hsa-miR-3175	CLIP-seq
MIRT2093083	hsa-miR-323b-3p	CLIP-seq
MIRT2093084	hsa-miR-4261	CLIP-seq
MIRT2093085	hsa-miR-429	CLIP-seq
MIRT2093086	hsa-miR-4468	CLIP-seq
MIRT2093087	hsa-miR-939	CLIP-seq
MIRT2317575	hsa-miR-1224-5p	CLIP-seq
MIRT2317576	hsa-miR-1255a	CLIP-seq
MIRT2317577	hsa-miR-1255b	CLIP-seq
MIRT2317578	hsa-miR-1270	CLIP-seq
MIRT2317579	hsa-miR-185	CLIP-seq
MIRT2317580	hsa-miR-1910	CLIP-seq
MIRT2317581	hsa-miR-1915	CLIP-seq
MIRT2093077	hsa-miR-200b	CLIP-seq
MIRT2093078	hsa-miR-200c	CLIP-seq
MIRT2317582	hsa-miR-2110	CLIP-seq
MIRT2317583	hsa-miR-2355-5p	CLIP-seq
MIRT2093080	hsa-miR-2681	CLIP-seq
MIRT2317584	hsa-miR-2861	CLIP-seq
MIRT2317585	hsa-miR-29a	CLIP-seq
MIRT2317586	hsa-miR-29b	CLIP-seq
MIRT2317587	hsa-miR-29c	CLIP-seq
MIRT2093081	hsa-miR-3150a-3p	CLIP-seq
MIRT2317588	hsa-miR-3150b-3p	CLIP-seq
MIRT2093082	hsa-miR-3175	CLIP-seq
MIRT2093083	hsa-miR-323b-3p	CLIP-seq
MIRT2317589	hsa-miR-3668	CLIP-seq
MIRT2317590	hsa-miR-3915	CLIP-seq
MIRT2317591	hsa-miR-3938	CLIP-seq
MIRT2317592	hsa-miR-4271	CLIP-seq
MIRT2093085	hsa-miR-429	CLIP-seq
MIRT2317593	hsa-miR-4306	CLIP-seq
MIRT1312906	hsa-miR-4434	CLIP-seq
MIRT2317594	hsa-miR-4512	CLIP-seq
MIRT1312908	hsa-miR-4516	CLIP-seq
MIRT2317595	hsa-miR-4528	CLIP-seq
MIRT2317596	hsa-miR-4530	CLIP-seq
MIRT2317597	hsa-miR-4531	CLIP-seq
MIRT2317598	hsa-miR-455-5p	CLIP-seq
MIRT2317599	hsa-miR-4644	CLIP-seq
MIRT2317600	hsa-miR-4650-5p	CLIP-seq
MIRT2317601	hsa-miR-4683	CLIP-seq
MIRT2317602	hsa-miR-4689	CLIP-seq
MIRT2317603	hsa-miR-4725-3p	CLIP-seq
MIRT2317604	hsa-miR-4726-3p	CLIP-seq
MIRT2317605	hsa-miR-4728-5p	CLIP-seq
MIRT2317606	hsa-miR-4747-5p	CLIP-seq
MIRT2317607	hsa-miR-4784	CLIP-seq
MIRT1312911	hsa-miR-4790-3p	CLIP-seq
MIRT2317608	hsa-miR-496	CLIP-seq
MIRT2317609	hsa-miR-520d-5p	CLIP-seq
MIRT2317610	hsa-miR-524-5p	CLIP-seq
MIRT2317611	hsa-miR-620	CLIP-seq
MIRT2317612	hsa-miR-634	CLIP-seq
MIRT2317613	hsa-miR-654-3p	CLIP-seq
MIRT2317614	hsa-miR-659	CLIP-seq
MIRT2317615	hsa-miR-765	CLIP-seq
MIRT2317616	hsa-miR-767-5p	CLIP-seq
MIRT2317617	hsa-miR-922	CLIP-seq
MIRT2093087	hsa-miR-939	CLIP-seq
MIRT2465986	hsa-miR-1273d	CLIP-seq
MIRT2465987	hsa-miR-3064-3p	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	23478265
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	33674311, 39255680
GO:0005737	Component	Cytoplasm	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032481	Process	Positive regulation of type I interferon production	IDA	12692549, 18636090
GO:0039532	Process	Negative regulation of cytoplasmic pattern recognition receptor signaling pathway	IDA	33674311
GO:0045087	Process	Innate immune response	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	33674311, 39255680
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	39255680
GO:0140896	Process	CGAS/STING signaling pathway	IDA	25636800
GO:0140896	Process	CGAS/STING signaling pathway	TAS	37403426
GO:0141111	Process	Positive regulation of cGAS/STING signaling pathway	IDA	39255680

MIM	HGNC	e!Ensembl
607524	18064	ENSG00000204618

Protein

UniProt ID

Q9H2S5

Protein name

RING finger protein 39 (EC 2.3.2.27) (Protein HZFw)

Protein function

Plays an inhibitory role in anti-RNA viral innate immunity by targeting the adapter DDX3X and promoting its 'Lys-48'-linked polyubiquitination (PubMed:33674311). Alternatively, enhances the cGAS-STING pathway activation by promoting 'Lys-63'-lin

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00097	zf-C3HC4	88 → 134	Zinc finger, C3HC4 type (RING finger)	Domain
PF13765	PRY	230 → 279	SPRY-associated domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis. {ECO:0000269|PubMed:11130983}.

Sequence

MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEG
AASRSWLSMDAPELGPGLVERLEQLATCPLCGGSFEDPVLLACEHSFCRACLARRWGTPP
ATGTEASPTACPCCGLPCPRRSLRSNVRLAVEVRISRELREKLAEPGARAGRRRGGRIPT
MGCLDLPGEDMRKTWRRFEVPTSKSSNSEDDLPEDYPVVKKMLHRLTADLTLDPGTAHRR
LLISADRRSVQLAPPGTPAPPDGPKRFDQLPAVLGAQGFGAGRHCWEVETADAASCRDSS
GEDADDEESHYAVGAAGESVQRKGCVRLCPAGAVWAVEGRGGRLWALTAPEPTLLGGVEP
PPRRIRVDLDWERGRVAFYDGRSLDLLYAFQAPGPLGERIFPLFCTCDPRAPLRIVPAES

Sequence length

420

Interactions

View interactions

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Cervical Cancer	Cervical cancer	N/A	N/A	GWAS
Lymphocytic Leukemia	Chronic lymphocytic leukemia	N/A	N/A	GWAS
Myasthenia Gravis	Myasthenia gravis	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS
Takayasu Arteritis	Takayasu arteritis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Cardio Renal Syndrome	Associate	26534935
Coronary Artery Disease	Inhibit	26534935
Coronary Artery Disease	Associate	26534935
Distal Myopathies	Associate	38015635
Infertility Male	Associate	31103287
Lesch Nyhan Syndrome	Stimulate	33875724
Metabolic Diseases	Associate	30782033
Multiple Sclerosis	Associate	28729889
Pain	Associate	38015635
Rhinitis Allergic	Associate	28149331

RNF39 (ring finger protein 39)