Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80350
Gene name Gene Name - the full gene name approved by the HGNC.
Lipoprotein(a) like 2 (pseudogene)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LPAL2
Synonyms (NCBI Gene) Gene synonyms aliases
APOA2, APOAL, APOARGC, apo(a)rg-C
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
Apolipoprotein(a) is the distinguishing protein moiety of lipoprotein(a), of which elevated plasma levels are correlated with an increased risk of atherosclerosis. This gene is similar to the lipoprotein, Lp(a) gene, but all transcripts produced by this g
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016940 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32814053
GO:0005576 Component Extracellular region IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611682 21210 ENSG00000290613
Protein
UniProt ID Q16609
Protein name Putative apolipoprotein(a)-like protein 2 (Apo(a)-like protein 2) (Lp(a)-liker protein 2) (Apolipoprotein a-related gene C protein) (Apo(a)rg-C)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00051 Kringle 28 105 Kringle domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in liver but not in other tissues tested. {ECO:0000269|PubMed:7749817}.
Sequence
MEHKEVVLLLLLFLKSAPTETGPSVQECYHSNGQSYRGTYFTTVTGRTCQAWSSMTPHQH
SRTPEKYPNDGLISNYCRNPDCSAGPWCYTTDPNVRWEYCNLTRC
SDDEGTVFVPLTVIP
VPSLEDSFIQVA
Sequence length 132
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Inhibit 36010685
Cardiomyopathies Associate 29447225
Cardiovascular Diseases Associate 37948393
Carotid Artery Diseases Associate 21127300
Cholangiocarcinoma Associate 30305026
Diabetes Mellitus Associate 21900290
Heart Failure Associate 29447225
Inflammation Associate 30305026
Myocardial Infarction Associate 21493818
Neoplasm Metastasis Inhibit 36010685