Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80347
Gene name Gene Name - the full gene name approved by the HGNC.
Coenzyme A synthase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
COASY
Synonyms (NCBI Gene) Gene synonyms aliases
DPCK, NBIA6, NBP, PCH12, PPAT, UKR1, pOV-2
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
Coenzyme A (CoA) functions as a carrier of acetyl and acyl groups in cells and thus plays an important role in numerous synthetic and degradative metabolic pathways in all organisms. In eukaryotes, CoA and its derivatives are also involved in membrane tra
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs587777136 C>T Pathogenic Coding sequence variant, stop gained
rs1022433060 A>C Likely-pathogenic Splice acceptor variant
rs1567903711 C>T Pathogenic Coding sequence variant, stop gained
rs1567904066 C>T Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030060 hsa-miR-26b-5p Microarray 19088304
MIRT050109 hsa-miR-26a-5p CLASH 23622248
MIRT043324 hsa-miR-331-3p CLASH 23622248
MIRT036719 hsa-miR-760 CLASH 23622248
MIRT566310 hsa-miR-548n PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0003824 Function Catalytic activity IEA
GO:0004140 Function Dephospho-CoA kinase activity IBA
GO:0004140 Function Dephospho-CoA kinase activity IDA 11923312, 11994049
GO:0004140 Function Dephospho-CoA kinase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609855 29932 ENSG00000068120
Protein
UniProt ID Q13057
Protein name Bifunctional coenzyme A synthase (CoA synthase) (NBP) (POV-2) [Includes: Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT); Dephospho-CoA kinase (DPCK) (EC 2.7.1.24) (D
Protein function Bifunctional enzyme that catalyzes the fourth and fifth sequential steps of CoA biosynthetic pathway. The fourth reaction is catalyzed by the phosphopantetheine adenylyltransferase, coded by the coaD domain; the fifth reaction is catalyzed by th
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01467 CTP_transf_like 195 339 Cytidylyltransferase-like Domain
PF01121 CoaE 359 535 Dephospho-CoA kinase Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues examined including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocyte. Lowest expression in peripheral blood leukocytes and highe
Sequence
MAVFRSGLLVLTTPLASLAPRLASILTSAARLVNHTLYVHLQPGMSLEGPAQPQSSPVQA
TFEVLDFITHLYAGADVHRHLDVRILLTNIRTKSTFLPPLPTSVQNLAHPPEVVLTDFQT
LDGSQYNPVKQQLVRYATSCYSCCPRLASVLLYSDYGIGEVPVEPLDVPLPSTIRPASPV
AGSPKQPVRGYYRGAVGGTFDRLHNAHKVLLSVACILAQEQLVVGVADKDLLKSKLLPEL
LQPYTERVEHLSEFLVDIKPSLTFDVIPLLDPYGPAGSDPSLEFLVVSEETYRGGMAINR
FRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQR
MLGNLLRPPYERPELPTCLYV
IGLTGISGSGKSSIAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGI
INRKVLGSRVFGNKKQLKILTDIMWPIIAKLAREEMDRAVAEGKRVCVIDAAVLLEAGWQ
NLVHEVWTAVIPETEAVRRIVERDGLSEAAAQSRLQSQMSGQQLVEQSHVVLSTL
WEPHI
TQRQVEKAWALLQKRIPKTHQALD
Sequence length 564
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of cofactors
  Coenzyme A biosynthesis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Ciliary Dyskinesia pontocerebellar hypoplasia, type 12 rs577714887, rs766482965 N/A
Neurodegeneration With Brain Iron Accumulation neurodegeneration with brain iron accumulation 6 rs587777136, rs1567904066, rs1597713743, rs140709867 N/A
neurodegeneration with brain iron accumulation Neurodegeneration with brain iron accumulation rs766482965, rs140709867 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 32699290
Amyotrophic lateral sclerosis 1 Associate 26704906
Arthrogryposis Associate 30089828
Bone Diseases Metabolic Associate 21092186
Cognitive Dysfunction Associate 32699290
Menopause Premature Associate 21198743
Microcephaly Associate 30089828
Neoplasms Associate 32828275
Neuroblastoma Associate 25671571
Neurodegenerative Diseases Associate 30089828, 32699290