Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80345
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger and SCAN domain containing 16
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZSCAN16
Synonyms (NCBI Gene) Gene synonyms aliases
ZNF392, ZNF435, dJ265C24.3
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT028787 hsa-miR-26b-5p Microarray 19088304
MIRT723121 hsa-miR-580-5p HITS-CLIP 19536157
MIRT723120 hsa-miR-646 HITS-CLIP 19536157
MIRT723119 hsa-miR-6736-3p HITS-CLIP 19536157
MIRT723118 hsa-miR-4530 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 16189514, 25416956, 32296183, 32814053
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
618544 20813 ENSG00000196812
Protein
UniProt ID Q9H4T2
Protein name Zinc finger and SCAN domain-containing protein 16 (Zinc finger protein 392) (Zinc finger protein 435)
Protein function May be involved in transcriptional regulation.
PDB 2COT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 37 126 SCAN domain Domain
PF00096 zf-C2H2 236 258 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 264 286 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 292 314 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 320 342 Zinc finger, C2H2 type Domain
Sequence
MTTALEPEDQKGLLIIKAEDHYWGQDSSSQKCSPHRRELYRQHFRKLCYQDAPGPREALT
QLWELCRQWLRPECHTKEQILDLLVLEQFLSILPKDLQAWVRAHHPETGEEAVTVLEDLE
RELDEP
GKQVPGNSERRDILMDKLAPLGRPYESLTVQLHPKKTQLEQEAGKPQRNGDKTR
TKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHPKSKDIIENEGRSEWQQRERRRYKCDE
CGKSFSHSSDLSKHRRTH
TGEKPYKCDECGKAFIQRSHLIGHHRVHTGVKPYKCKECGKD
FSGRTGLIQHQRIH
TGEKPYECDECGRPFRVSSALIRHQRIHTANKLY
Sequence length 348
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Cervical Cancer Cervical cancer N/A N/A GWAS
Colorectal Cancer Colorectal cancer (age of onset) N/A N/A GWAS
Dental caries Dental caries N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Ovarian Neoplasms Associate 32332753