Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	80342
Gene name	TRAF3 interacting protein 3
Gene symbol	TRAF3IP3
Synonyms (NCBI Gene)	T3JAM
Chromosome	1
Chromosome location	1q32.2
Summary	The gene encodes a protein that mediates cell growth by modulating the c-Jun N-terminal kinase signal transduction pathway. The encoded protein may also interact with a large multi-protein assembly containing the phosphatase 2A catalytic subunit. Alternat

Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026450	hsa-miR-192-5p	Microarray	19074876
MIRT1450973	hsa-miR-1273e	CLIP-seq
MIRT1450974	hsa-miR-219-1-3p	CLIP-seq
MIRT1450975	hsa-miR-3920	CLIP-seq
MIRT1450976	hsa-miR-3977	CLIP-seq
MIRT1450977	hsa-miR-4327	CLIP-seq
MIRT1450978	hsa-miR-4682	CLIP-seq
MIRT1450979	hsa-miR-4762-3p	CLIP-seq
MIRT1450980	hsa-miR-571	CLIP-seq
MIRT1450981	hsa-miR-639	CLIP-seq
MIRT2356069	hsa-miR-5096	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IBA
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	31390091
GO:0005515	Function	Protein binding	IPI	18782753, 25416956, 25910212, 31515488, 32226298, 32296183, 32814053, 33961781
GO:0005739	Component	Mitochondrion	IDA	31390091
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	31390091
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	31390091
GO:0032481	Process	Positive regulation of type I interferon production	IDA	19898473
GO:0032481	Process	Positive regulation of type I interferon production	IDA	31390091
GO:0060090	Function	Molecular adaptor activity	IBA
GO:0060090	Function	Molecular adaptor activity	IDA	31390091

MIM	HGNC	e!Ensembl
608255	30766	ENSG00000009790

Q9Y228

Protein name

TRAF3-interacting JNK-activating modulator (TRAF3-interacting protein 3)

Protein function

Adapter protein that plays essential roles in both innate and adaptive immunity. Plays a crucial role in the regulation of thymocyte development (PubMed:26195727). Mechanistically, mediates TCR-stimulated activation through recruiting MAP2K1/MEK

Family and domains

Sequence

MISPDPRPSPGLARWAESYEAKCERRQEIRESRRCRPNVTTCRQVGKTLRIQQREQLQRA
RLQQFFRRRNLELEEKGKAQHPQAREQGPSRRPGQVTVLKEPLSCARRISSPREQVTGTS
SEVFPAQHPPPSGICRDLSDHLSSQAGGLPPQDTPIKKPPKHHRGTQTKAEGPTIKNDAS
QQTNYGVAVLDKEIIQLSDYLKEALQRELVLKQKMVILQDLLSTLIQASDSSWKGQLNED
KLKGKLRSLENQLYTCTQKYSPWGMKKVLLEMEDQKNSYEQKAKESLQKVLEEKMNAEQQ
LQSTQRSLALAEQKCEEWRSQYEALKEDWRTLGTQHRELESQLHVLQSKLQGADSRDLQM
NQALRFLENEHQQLQAKIECLQGDRDLCSLDTQDLQDQLKRSEAEKLTLVTRVQQLQGLL
QNQSLQLQEQEKLLTKKDQALPVWSPKSFPNEVEPEGTGKEKDWDLRDQLQKKTLQLQAK
EKECRELHSELDNLSDEYLSCLRKLQHCREELNQSQQLPPRRQCGRWLPVLMVVIAAALA
VFLANKDNLMI

Sequence length

551

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OROFACIAL CLEFT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	30587197	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	38355839	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	35885892, 36551164	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Associate	33568133	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Associate	36397361	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Associate	38355839	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	33503336	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Associate	25779945	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	32034058	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	37284741	★★★★★ ★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Associate	33137956	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	37284741	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	33503336	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Associate	25779945	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	32034058	★★★★★ ★☆☆☆☆ Found in Text Mining only

TRAF3IP3 (TRAF3 interacting protein 3)