Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	80333
Gene name	Potassium voltage-gated channel interacting protein 4
Gene symbol	KCNIP4
Synonyms (NCBI Gene)	CALPKCHIP4
Chromosome	4
Chromosome location	4p15.31-p15.2
Summary	This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have

Show/Hide all (16)

miRTarBase ID	miRNA	Experiments
MIRT1081167	hsa-miR-4477a	CLIP-seq
MIRT1081168	hsa-miR-4503	CLIP-seq
MIRT1081169	hsa-miR-4668-3p	CLIP-seq
MIRT1081170	hsa-miR-4698	CLIP-seq
MIRT1081171	hsa-miR-548aa	CLIP-seq
MIRT2452199	hsa-miR-1283	CLIP-seq
MIRT2452200	hsa-miR-3145-3p	CLIP-seq
MIRT2452201	hsa-miR-338-5p	CLIP-seq
MIRT2452202	hsa-miR-3689a-5p	CLIP-seq
MIRT2452203	hsa-miR-3689b	CLIP-seq
MIRT2452204	hsa-miR-3689e	CLIP-seq
MIRT2452205	hsa-miR-3689f	CLIP-seq
MIRT2452206	hsa-miR-4666-3p	CLIP-seq
MIRT2452207	hsa-miR-548c-3p	CLIP-seq
MIRT2452208	hsa-miR-570	CLIP-seq
MIRT2452209	hsa-miR-758	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005267	Function	Potassium channel activity	IEA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	11847232
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	26871637, 32296183
GO:0005737	Component	Cytoplasm	IDA	11847232
GO:0005737	Component	Cytoplasm	IEA
GO:0005777	Component	Peroxisome	IDA	22057399
GO:0005777	Component	Peroxisome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005886	Component	Plasma membrane	IDA	11847232
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	ISS
GO:0009966	Process	Regulation of signal transduction	IBA
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0015459	Function	Potassium channel regulator activity	IEA
GO:0015459	Function	Potassium channel regulator activity	ISS
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0072659	Process	Protein localization to plasma membrane	ISS
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IBA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IEA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	ISS

MIM	HGNC	e!Ensembl
608182	30083	ENSG00000185774

Q6PIL6

Protein name

Kv channel-interacting protein 4 (KChIP4) (A-type potassium channel modulatory protein 4) (Calsenilin-like protein) (Potassium channel-interacting protein 4)

Protein function

Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Modulates KCND2 channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manne

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13833	EF-hand_8	99 → 152	EF-hand domain pair	Domain
PF13499	EF-hand_7	158 → 234	EF-hand domain pair	Domain
PF13202	EF-hand_5	209 → 233	EF hand	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in brain. {ECO:0000269|PubMed:11847232}.

Sequence

MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDE
LEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGD
STTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEE
MLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIM
RSMQLFENVI

Sequence length

250

Interactions

View interactions

	Reactome
			Phase 1 - inactivation of fast Na+ channels

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
KCNIP4-related disorder	Benign	rs2322688, rs3765122, rs3765121	RCV003979608 RCV003982094 RCV003982096

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	21624954, 40631452
Arrhythmias Cardiac	Associate	28575239
Cough	Associate	26169577
Dementia	Associate	36421848
Lung Neoplasms	Associate	25644374
Pancreatic Neoplasms	Associate	24419231
Pyruvate Carboxylase Deficiency Disease	Associate	34593906
Renal Insufficiency Chronic	Associate	34593906

KCNIP4 (potassium voltage-gated channel interacting protein 4)