KCNIP4 (potassium voltage-gated channel interacting protein 4)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80333
Gene name Gene Name - the full gene name approved by the HGNC.
Potassium voltage-gated channel interacting protein 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KCNIP4
Synonyms (NCBI Gene) Gene synonyms aliases
CALP, KCHIP4
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p15.31-p15.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(16)
miRTarBase ID miRNA Experiments Reference
MIRT1081167 hsa-miR-4477a CLIP-seq
MIRT1081168 hsa-miR-4503 CLIP-seq
MIRT1081169 hsa-miR-4668-3p CLIP-seq
MIRT1081170 hsa-miR-4698 CLIP-seq
MIRT1081171 hsa-miR-548aa CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(16)
GO ID Ontology Definition Evidence Reference
GO:0005244 Function Voltage-gated ion channel activity IEA
GO:0005267 Function Potassium channel activity IEA
GO:0005509 Function Calcium ion binding IDA 11847232
GO:0005515 Function Protein binding IPI 26871637, 32296183
GO:0005737 Component Cytoplasm IDA 11847232
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
608182 30083 ENSG00000185774
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q6PIL6
Protein name Kv channel-interacting protein 4 (KChIP4) (A-type potassium channel modulatory protein 4) (Calsenilin-like protein) (Potassium channel-interacting protein 4)
Protein function Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Modulates KCND2 channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manne
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13833 EF-hand_8 99 → 152 EF-hand domain pair Domain
PF13499 EF-hand_7 158 → 234 EF-hand domain pair Domain
PF13202 EF-hand_5 209 → 233 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in brain. {ECO:0000269|PubMed:11847232}.
Sequence 
MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDE
LEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGD
STTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEE
MLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIM
RSMQLFENVI
Sequence length 250
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Phase 1 - inactivation of fast Na+ channels
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (4)
Causal
Disease term Disease name dbSNP ID References
Colonic neoplasms Malignant tumor of colon rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483 29228715
Colorectal cancer Colorectal Carcinoma, Adenocarcinoma of large intestine rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)		 29228715
Colorectal neoplasms Colorectal Neoplasms, Malignant neoplasm of large intestine rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049
View all (1682 more)		 29228715
Parkinson disease Parkinson Disease rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432
View all (84 more)		 25663231
Show/Hide Unknown Diseases (6)
Unknown
Disease term Disease name Evidence References Source
Neuroticism Neuroticism GWAS
Rheumatoid arthritis Rheumatoid arthritis GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Colorectal Cancer Colorectal Cancer In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1. GWAS, CBGDA
Show/Hide Text Mining Associations (8)
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 21624954, 40631452
Arrhythmias Cardiac Associate 28575239
Cough Associate 26169577
Dementia Associate 36421848
Lung Neoplasms Associate 25644374
Pancreatic Neoplasms Associate 24419231
Pyruvate Carboxylase Deficiency Disease Associate 34593906
Renal Insufficiency Chronic Associate 34593906