Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80333
Gene name Gene Name - the full gene name approved by the HGNC.
Potassium voltage-gated channel interacting protein 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KCNIP4
Synonyms (NCBI Gene) Gene synonyms aliases
CALP, KCHIP4
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p15.31-p15.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1081167 hsa-miR-4477a CLIP-seq
MIRT1081168 hsa-miR-4503 CLIP-seq
MIRT1081169 hsa-miR-4668-3p CLIP-seq
MIRT1081170 hsa-miR-4698 CLIP-seq
MIRT1081171 hsa-miR-548aa CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005267 Function Potassium channel activity IEA
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IDA 11847232
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 26871637, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608182 30083 ENSG00000185774
Protein
UniProt ID Q6PIL6
Protein name Kv channel-interacting protein 4 (KChIP4) (A-type potassium channel modulatory protein 4) (Calsenilin-like protein) (Potassium channel-interacting protein 4)
Protein function Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Modulates KCND2 channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manne
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13833 EF-hand_8 99 152 EF-hand domain pair Domain
PF13499 EF-hand_7 158 234 EF-hand domain pair Domain
PF13202 EF-hand_5 209 233 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in brain. {ECO:0000269|PubMed:11847232}.
Sequence
MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDE
LEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGD
STTYAHFLFNAFDTDHNGAVSFEDFIKGLSIL
LRGTVQEKLNWAFNLYDINKDGYITKEE
MLDIMKAIYDMMGKCTYPVLKEDAPRQH
VETFFQKMDKNKDGVVTIDEFIESCQKDENIM
RSMQLFENVI
Sequence length 250
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Phase 1 - inactivation of fast Na+ channels
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Neuroticism Neuroticism N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 21624954, 40631452
Arrhythmias Cardiac Associate 28575239
Cough Associate 26169577
Dementia Associate 36421848
Lung Neoplasms Associate 25644374
Pancreatic Neoplasms Associate 24419231
Pyruvate Carboxylase Deficiency Disease Associate 34593906
Renal Insufficiency Chronic Associate 34593906