Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	80326
Gene name Gene Name - the full gene name approved by the HGNC.	Wnt family member 10A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	WNT10A
Synonyms (NCBI Gene) Gene synonyms aliases	ECTD16, OODD, SSPS, STHAG4
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q35
Summary Summary of gene provided in NCBI Entrez Gene.	The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

Show/Hide all(26)

SNP ID	Visualize variation	Clinical significance	Consequence
rs34972707	A>C	Likely-benign, pathogenic, conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs77583146	G>A	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, intron variant, missense variant
rs116998555	C>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign	Intron variant, coding sequence variant, missense variant
rs121908118	G>A,T	Pathogenic	Intron variant, stop gained, coding sequence variant, missense variant
rs121908120	T>A	Conflicting-interpretations-of-pathogenicity, benign, pathogenic, likely-benign	Intron variant, coding sequence variant, missense variant
rs121908121	G>A	Likely-pathogenic, not-provided, pathogenic	Intron variant, coding sequence variant, missense variant
rs121908122	C>A	Pathogenic	Stop gained, coding sequence variant, missense variant
rs146902156	G>A	Likely-benign, not-provided, pathogenic	Missense variant, coding sequence variant, intron variant
rs147680216	G>A	Likely-benign, pathogenic, benign, uncertain-significance	Missense variant, coding sequence variant, intron variant
rs372993798	G>A,T	Pathogenic, likely-pathogenic	Intron variant, coding sequence variant, missense variant
rs750260671	G>A,T	Likely-pathogenic	Coding sequence variant, stop gained, missense variant
rs762739726	C>T	Pathogenic, likely-pathogenic	Coding sequence variant, stop gained, intron variant
rs775380022	G>A	Likely-pathogenic	Missense variant, coding sequence variant, intron variant
rs775990266	G>-,GG	Pathogenic	Coding sequence variant, frameshift variant
rs886039453	C>T	Pathogenic	Stop gained, coding sequence variant, intron variant
rs886039454	C>G	Pathogenic	Stop gained, coding sequence variant, synonymous variant
rs886041618	->C	Pathogenic	Coding sequence variant, frameshift variant
rs1011303295	T>A,C	Pathogenic	Missense variant, coding sequence variant
rs1057520655	A>G	Pathogenic	Missense variant, coding sequence variant, intron variant
rs1060499588	C>T	Likely-pathogenic	Coding sequence variant, stop gained, intron variant
rs1085308031	G>A	Likely-pathogenic	Synonymous variant, missense variant, coding sequence variant
rs1268725013	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1553623281	AT>-	Pathogenic	Frameshift variant, coding sequence variant
rs1553623389	C>A	Pathogenic	Stop gained, coding sequence variant, missense variant
rs1575233692	C>-	Pathogenic	Frameshift variant, intron variant, coding sequence variant
rs1575235227	G>A	Pathogenic	Synonymous variant, coding sequence variant, missense variant

Show/Hide all(58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053636	hsa-miR-130a-3p	Microarray	22942087
MIRT533154	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT533153	hsa-miR-4690-3p	PAR-CLIP	22012620
MIRT533152	hsa-miR-5685	PAR-CLIP	22012620
MIRT533151	hsa-miR-361-3p	PAR-CLIP	22012620
MIRT533150	hsa-miR-4539	PAR-CLIP	22012620
MIRT533149	hsa-miR-1285-3p	PAR-CLIP	22012620
MIRT533148	hsa-miR-3187-5p	PAR-CLIP	22012620
MIRT533147	hsa-miR-5189-5p	PAR-CLIP	22012620
MIRT533146	hsa-miR-612	PAR-CLIP	22012620
MIRT533145	hsa-miR-6860	PAR-CLIP	22012620
MIRT533144	hsa-miR-4486	PAR-CLIP	22012620
MIRT533143	hsa-miR-378g	PAR-CLIP	22012620
MIRT533142	hsa-miR-3120-5p	PAR-CLIP	22012620
MIRT533141	hsa-miR-27a-5p	PAR-CLIP	22012620
MIRT533140	hsa-miR-203b-3p	PAR-CLIP	22012620
MIRT533139	hsa-miR-1231	PAR-CLIP	22012620
MIRT726098	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT726097	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT736197	hsa-miR-378a-3p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27832641
MIRT736197	hsa-miR-378a-3p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27832641
MIRT533151	hsa-miR-361-3p	HITS-CLIP	28735896
MIRT533153	hsa-miR-4690-3p	HITS-CLIP	28735896
MIRT533152	hsa-miR-5685	HITS-CLIP	28735896
MIRT736197	hsa-miR-378a-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	32829178
MIRT533151	hsa-miR-361-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33299350
MIRT533154	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT533153	hsa-miR-4690-3p	PAR-CLIP	22012620
MIRT533152	hsa-miR-5685	PAR-CLIP	22012620
MIRT533151	hsa-miR-361-3p	PAR-CLIP	22012620
MIRT533150	hsa-miR-4539	PAR-CLIP	22012620
MIRT533149	hsa-miR-1285-3p	PAR-CLIP	22012620
MIRT533148	hsa-miR-3187-5p	PAR-CLIP	22012620
MIRT533147	hsa-miR-5189-5p	PAR-CLIP	22012620
MIRT533146	hsa-miR-612	PAR-CLIP	22012620
MIRT533145	hsa-miR-6860	PAR-CLIP	22012620
MIRT533144	hsa-miR-4486	PAR-CLIP	22012620
MIRT533143	hsa-miR-378g	PAR-CLIP	22012620
MIRT533142	hsa-miR-3120-5p	PAR-CLIP	22012620
MIRT533141	hsa-miR-27a-5p	PAR-CLIP	22012620
MIRT533140	hsa-miR-203b-3p	PAR-CLIP	22012620
MIRT533139	hsa-miR-1231	PAR-CLIP	22012620
MIRT755397	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR	35958896
MIRT1493547	hsa-miR-2392	CLIP-seq
MIRT1493548	hsa-miR-4494	CLIP-seq
MIRT1493549	hsa-miR-4499	CLIP-seq
MIRT1493550	hsa-miR-4513	CLIP-seq
MIRT1493551	hsa-miR-451b	CLIP-seq
MIRT1493552	hsa-miR-4534	CLIP-seq
MIRT1493553	hsa-miR-4641	CLIP-seq
MIRT2148778	hsa-miR-3165	CLIP-seq
MIRT2148779	hsa-miR-3179	CLIP-seq
MIRT2148780	hsa-miR-4695-5p	CLIP-seq
MIRT2148781	hsa-miR-4790-3p	CLIP-seq
MIRT2148782	hsa-miR-765	CLIP-seq
MIRT2463526	hsa-miR-3183	CLIP-seq
MIRT2463527	hsa-miR-4723-3p	CLIP-seq
MIRT2463528	hsa-miR-500a	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001942	Process	Hair follicle development	IMP	17847007, 19559398
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005109	Function	Frizzled binding	IBA
GO:0005125	Function	Cytokine activity	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0014033	Process	Neural crest cell differentiation	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0031069	Process	Hair follicle morphogenesis	IMP	20163410
GO:0042476	Process	Odontogenesis	IMP	17847007, 19559398
GO:0042487	Process	Regulation of odontogenesis of dentin-containing tooth	IEA
GO:0043586	Process	Tongue development	IMP	17847007, 19559398
GO:0043588	Process	Skin development	IMP	17847007, 19559398
GO:0045165	Process	Cell fate commitment	IBA
GO:0048018	Function	Receptor ligand activity	IDA	28733458
GO:0048513	Process	Animal organ development	IEA
GO:0048730	Process	Epidermis morphogenesis	IMP	20163410
GO:0048733	Process	Sebaceous gland development	IMP	19559398
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	28733458
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEP	15040835

MIM	HGNC	e!Ensembl
606268	13829	ENSG00000135925

Protein

UniProt ID

Q9GZT5

Protein name

Protein Wnt-10a

Protein function

Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Functions in the canonical Wnt/beta-catenin signaling pathway (By similarity). Plays a role in normal ectoderm development (PubMed:17847007, PubMed:28589954).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00110	wnt	63 → 417	wnt family	Family

Sequence

MGSAHPRPWLRLRPQPQPRPALWVLLFFLLLLAAAMPRSAPNDILDLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRSRFHRATLI
RPHNRNGGQLEPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGSDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK

Sequence length

417

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway Wnt signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Melanogenesis Cushing syndrome Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Pathways in cancer Proteoglycans in cancer Basal cell carcinoma Breast cancer Hepatocellular carcinoma Gastric cancer		WNT ligand biogenesis and trafficking

Show/Hide Causal Diseases (2)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Odontoonychodermal dysplasia	odonto-onycho-dermal dysplasia	rs1011303295, rs121908123, rs1575233692, rs1575235227, rs886039453, rs750260671, rs121908118, rs543063101, rs121908119, rs764658964, rs1553623281, rs121908121, rs775990266, rs1553623389, rs121908122	N/A
tooth agenesis	Tooth agenesis, selective, 4	rs318240759, rs372993798, rs773036759, rs121908119, rs121908121	N/A

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Acne	acne vulgaris	N/A	N/A	GWAS
Bladder Exstrophy And Epispadias Complex	Bladder exstrophy-epispadias-cloacal extrophy complex	N/A	N/A	ClinVar
hypohidrotic ectodermal dysplasia	Hypohidrotic ectodermal dysplasia	N/A	N/A	ClinVar
Hypohidrotic ectodermal dysplasia	autosomal recessive hypohidrotic ectodermal dysplasia	N/A	N/A	GenCC

Show/Hide Text Mining Associations (64)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenoma	Associate	21547848
Alopecia	Associate	23358095, 34118813, 34506541
Alopecia Areata	Associate	34118813
Amelogenesis imperfecta local hypoplastic form	Associate	35537890
Anodontia	Associate	19471313, 22581971, 23227268, 23991204, 24312213, 24631698, 24700731, 26964878, 27049303, 27665865, 27881089, 28813618, 28944914, 30046887, 31652981 View all (5 more)
Anodontia of Permanent Dentition	Associate	26964878
Autoimmune Diseases	Associate	34118813
Breast Neoplasms	Associate	23372744
Calcinosis	Associate	36605938
Carcinogenesis	Associate	17767013, 24631698
Carcinogenesis	Stimulate	23094073
Carcinoma Renal Cell	Stimulate	23094073
Cholangiocarcinoma	Stimulate	39831920
Conversion Disorder	Associate	36017684
Cysts	Associate	19559398
Deafness	Associate	28944914
Deafness Autosomal Recessive	Associate	30046887
Deafness oligodontia syndrome	Associate	19559398, 24312213, 26387593, 27650966, 27881089, 31652981, 34228861, 34593752, 37422997
Dental Pulp Calcification	Associate	37566620
Dry Eye Syndromes	Associate	19471313
Eccrine Syringofibroadenomatosis with Eyelid Abnormalities	Associate	26964878
Ectodermal Dysplasia	Associate	17847007, 19559398, 24700731, 26964878, 27049303, 27881089, 28944914, 30974434, 31796081, 34118813, 36421794
Ectodermal Dysplasia 1 Anhidrotic	Associate	24312213, 38280992
Ectodermal Dysplasia Hypohidrotic Autosomal Recessive	Associate	30974434
Fibrosis	Associate	25054240, 29955137
Genetic Diseases Inborn	Associate	22581971
Gomez Lopez Hernandez syndrome	Associate	17847007, 19471313, 19559398, 24398796, 24700731, 26964878
Hairy palms and soles	Associate	19471313, 27881089
Hamman Rich Syndrome	Associate	25054240
Hydatidiform Mole	Associate	37566620
Hyperhidrosis	Associate	26964878
Hypogonadism	Associate	28944914
Hypophosphatasia	Associate	39519277
Intervertebral Disc Degeneration	Associate	33090383
Keratoconus	Associate	26049155, 33988693
Kidney Diseases	Associate	25054240
Leukemia Lymphocytic Chronic B Cell	Associate	14973184
Leukemia Myeloid Acute	Associate	17767013, 37885041
Microphthalmia syndromic 2	Associate	30046887
Muscular Dystrophy Congenital Megaconial Type	Associate	36017684
Nail Diseases	Associate	19471313
Nail Patella Syndrome	Associate	19471313, 24312213
Nails Malformed	Associate	27881089, 36421794
Neoplasms	Associate	25054240, 35704796
Nephritis Interstitial	Associate	25054240
Neural crest tumor	Associate	31796081
Odontoonychodermal dysplasia	Associate	22581971
Papillary Thyroid Microcarcinoma	Associate	36605938
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	22426169
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	22426169, 33417298
Radiculopathy	Associate	35537890
Retinal Dysplasia	Associate	22581971
Schopf Schulz Passarge Syndrome	Associate	19559398, 24312213, 24398796, 26964878
Scoliosis	Associate	34440365
Signs and Symptoms	Associate	27881089
Skin Abnormalities	Associate	28944914
Skin Neoplasms	Associate	19559398
Taurodontism	Associate	37422997
Thyroid Cancer Papillary	Inhibit	37208504
Tooth Abnormalities	Associate	19559398
Tooth Agenesis Selective 4	Associate	24700731, 30046887
Urinary Bladder Neoplasms	Associate	26722457
Witkop syndrome	Associate	19559398
Zlotogora Ogur syndrome	Associate	17847007

WNT10A (Wnt family member 10A)