Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80323
Gene name Gene Name - the full gene name approved by the HGNC.
Coiled-coil domain containing 68
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCDC68
Synonyms (NCBI Gene) Gene synonyms aliases
SE57-1
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q21.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022785 hsa-miR-124-3p Microarray 18668037
MIRT628349 hsa-miR-6808-5p HITS-CLIP 23824327
MIRT628348 hsa-miR-6893-5p HITS-CLIP 23824327
MIRT628347 hsa-miR-940 HITS-CLIP 23824327
MIRT628346 hsa-miR-4768-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 28422092, 28514442, 31515488, 32296183
GO:0005622 Component Intracellular anatomical structure IBA 21873635
GO:0005737 Component Cytoplasm IEA
GO:0005814 Component Centriole IDA 28422092
GO:0008104 Process Protein localization IMP 28422092
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616909 24350 ENSG00000166510
Protein
UniProt ID Q9H2F9
Protein name Coiled-coil domain-containing protein 68 (Cutaneous T-cell lymphoma-associated antigen se57-1) (CTCL-associated antigen se57-1)
Protein function Centriolar protein required for centriole subdistal appendage assembly and microtubule anchoring in interphase cells (PubMed:28422092). Together with CCDC120, cooperate with subdistal appendage components ODF2, NIN and CEP170 for hierarchical su
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in bone marrow, colon, small intestine, spleen, testis, trachea and cutaneous T-cell lymphoma (CTCL). {ECO:0000269|PubMed:11149944, ECO:0000269|PubMed:15142679}.
Sequence
MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDS
TNHKLDAKHCGNLQQGSDSEMDPSCCSLDLLMKKIKGKDLQLLEMNKENEVLKIKLQASR
EAGAAALRNVAQRLFENYQTQSEEVRKKQEDSKQLLQVNKLEKEQKLKQHVENLNQVAEK
LEEKHSQITELENLVQRMEKEKRTLLERKLSLENKLLQLKSSATYGKSCQDLQREISILQ
EQISHLQFVIHSQHQNLRSVIQEMEGLKNNLKEQDKRIENLREKVNILEAQNKELKTQVA
LSSETPRTKVSKAVSTSELKTEGVSPYLMLIRLRK
Sequence length 335
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Narcolepsy Narcolepsy rs104894574, rs387906655 19629137
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
23439384
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Neuroticism Neuroticism GWAS
Pancreatic cancer Pancreatic cancer Genome-Wide CRISPR Screening Identifies DCK and CCNL1 as Genes That Contribute to Gemcitabine Resistance in Pancreatic Cancer GWAS, CBGDA
Mental Depression Mental Depression GWAS
Associations from Text Mining
Disease Name Relationship Type References
Colorectal Neoplasms Associate 19359472
Neoplasms Inhibit 19359472