Gene Gene information from NCBI Gene database.
Entrez ID 80321
Gene name Centrosomal protein 70
Gene symbol CEP70
Synonyms (NCBI Gene)
BITE
Chromosome 3
Chromosome location 3q22.3
miRNA miRNA information provided by mirtarbase database.
113
miRTarBase ID miRNA Experiments Reference
MIRT020024 hsa-miR-375 Microarray 20215506
MIRT639180 hsa-miR-1272 HITS-CLIP 23824327
MIRT639179 hsa-miR-1470 HITS-CLIP 23824327
MIRT639178 hsa-miR-4667-3p HITS-CLIP 23824327
MIRT639177 hsa-miR-519d-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 16713569, 19060904, 21900206, 23455924, 25416956, 25910212, 26871637, 27107012, 29892012, 31515488, 32296183, 32814053, 35914814
GO:0005737 Component Cytoplasm IEA
GO:0005813 Component Centrosome IDA 21399614
GO:0005813 Component Centrosome IEA
GO:0005815 Component Microtubule organizing center IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614310 29972 ENSG00000114107
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NHQ1
Protein name Centrosomal protein of 70 kDa (Cep70) (p10-binding protein)
Protein function Plays a role in the organization of both preexisting and nascent microtubules in interphase cells. During mitosis, required for the organization and orientation of the mitotic spindle.
Family and domains
Sequence
MFPVAPKPQDSSQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRTDLKDLIIFDK
QSSQRMRQNLKLLVEETSCQQNMIQELIETNQQLRNELQLEQSRAANQEQRANDLEQIME
SVKSKIGELEDESLSRACHQQNKIKDLQKEQKTLQVKCQHYKKKRTEQEETIASLQMEVC
RLKKEEEDRIVTQNRVFAYLCKRVPHTVLDRQLLCLIDYYESKIRKIHTQRQYKEDESQS
EEENDYRNLDASPTYKGLLMSLQNQLKESKSKIDALSSEKLNLQKDLETRPTQHELRLYK
QQVKKLEKALKKNVKLQELINHKKAEDTEKKDEPSKYNQQQALIDQRYFQVLCSINSIIH
NPRAPVIIYKQTKGGVQNFNKDLVQDCGFEHLVPVIEMWADQLTSLKDLYKSLKTLSAEL
VPWLNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPHFQTLQAIVSHFQKLFDVP
SLNGVYPRMNEVYTRLGEMNNAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNEQV
MQVLGPEDLQSIIYKLEEHEEFFPAFQAFTNDLLEILEIDDLDAIVPAVKKLKVLSY
Sequence length 597
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
3
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Median cleft lip and palate Uncertain significance rs201584232, rs200041935, rs1410139717 RCV001257358
RCV001257357
RCV001257359
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Arrest of spermatogenesis Associate 33980814
Azoospermia Associate 33980814
Breast Neoplasms Stimulate 28063737
Breast Neoplasms Associate 28109768, 28632150
Colorectal Neoplasms Associate 20616015
Infertility Male Associate 33980814
Lymphoma B Cell Associate 35228544
Neoplasm Metastasis Stimulate 28063737
Neoplasm Metastasis Associate 28109768, 28632150
Neoplasms Inhibit 20616015