Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	80318
Gene name	G kinase anchoring protein 1
Gene symbol	GKAP1
Synonyms (NCBI Gene)	FKSG21GKAP42
Chromosome	9
Chromosome location	9q21.32
Summary	This gene encodes a protein that is highly similar to the mouse cGMP-dependent protein kinase anchoring protein 42kDa. The mouse protein has been found to localize with the Golgi and recruit cGMP-dependent protein kinase I alpha to the Golgi in mouse test

Show/Hide all (16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019677	hsa-miR-375	Microarray	20215506
MIRT1020302	hsa-miR-153	CLIP-seq
MIRT1020303	hsa-miR-217	CLIP-seq
MIRT1020304	hsa-miR-548a-3p	CLIP-seq
MIRT1020305	hsa-miR-548ae	CLIP-seq
MIRT1020306	hsa-miR-548aj	CLIP-seq
MIRT1020307	hsa-miR-548am	CLIP-seq
MIRT1020308	hsa-miR-548e	CLIP-seq
MIRT1020309	hsa-miR-548f	CLIP-seq
MIRT1020310	hsa-miR-548x	CLIP-seq
MIRT1020311	hsa-miR-599	CLIP-seq
MIRT2002152	hsa-miR-1287	CLIP-seq
MIRT2002153	hsa-miR-3135b	CLIP-seq
MIRT2002154	hsa-miR-4659a-3p	CLIP-seq
MIRT2002155	hsa-miR-4659b-3p	CLIP-seq
MIRT2002156	hsa-miR-4684-5p	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	ISS
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0019934	Process	CGMP-mediated signaling	ISS
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IEA
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	ISS

MIM	HGNC	e!Ensembl
611356	17496	ENSG00000165113

Q5VSY0

Protein name

G kinase-anchoring protein 1 (cGMP-dependent protein kinase-anchoring protein of 42 kDa)

Protein function

Regulates insulin-dependent IRS1 tyrosine phosphorylation in adipocytes by modulating the availability of IRS1 to IR tyrosine kinase. Its association with IRS1 is required for insulin-induced translocation of SLC2A4 to the cell membrane. Involve

Family and domains

Sequence

MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRR
KKKEQQQSEANELRNLAFKKIPQKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQ
LTSEMFEADLEKALLLSKLEYEEHKKEYEDAENTSTQSKVMNKKDKRKNHQGKDRPLTVS
LKDFHSEDHISKKTEELSSSQTLSHDGGFFNRLEDDVHKILIREKRREQLTEYNGTDNCT
AHEHNQEVVLKDGRIERLKLELERKDAEIQKLKNVITQWEAKYKEVKARNAQLLKMLQEG
EMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKYQGGRKGKRNS
ESDQCR

Sequence length

366

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Bladder Exstrophy	Associate	37509153	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	33820494	★★★★★ ★☆☆☆☆ Found in Text Mining only

GKAP1 (G kinase anchoring protein 1)